DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t3 and CYP702A3

DIOPT Version :9

Sequence 1:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_193266.2 Gene:CYP702A3 / 827197 AraportID:AT4G15310 Length:475 Species:Arabidopsis thaliana


Alignment Length:550 Identity:111/550 - (20%)
Similarity:191/550 - (34%) Gaps:159/550 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LTIVTLNFWLRHKYDYFRSRGIPHLPPSSWSPMGNLGQLLFLRISFGDLFRQLYADPRNGQAKIV 73
            |.:|.|..|:   |.:...:....|||      |::|                        ..|:
plant    15 LIVVKLCHWV---YQWSNPKCKGKLPP------GSMG------------------------FPII 46

  Fly    74 G-FFIFQTP--ALMVRDPELIRQVL---IKNFNNFLNRFESADAGDPMGALTLPLAKYHHWKESR 132
            | .|.|.||  ..:|..|.|.:::.   .|.|...|...:...:.||  .:.:.:||......:.
plant    47 GETFEFMTPFDISLVVSPYLKKRISRYGSKVFRTSLFGAKVIVSIDP--DVNMEIAKASSQLRAT 109

  Fly   133 QCMSQLFTSGRMRDVMYSQMLDVASDLEQYLNRKLGDRLERVLPLGRMCQLYTTDVTGNLFYSLN 197
            :.::::|  |.....:.|:      ::.:|: |.|..|.  |.|.|...:| ..|: .||..:..
plant   110 ESVTRIF--GENNPFLQSK------EIHKYV-RNLTSRF--VGPEGLKTRL-IHDI-DNLLRNDV 161

  Fly   198 VGGLRRGR-----------SELITK----------TKEL------FNTN---------------- 219
            ..|.|.|.           .|||.|          .|||      |.|:                
plant   162 ENGARNGSFDVREATIKMVGELIAKKIMGETESEAVKELGLCWSAFRTSWFQFSYNIPGTTVYRL 226

  Fly   220 ---PRKVLDFMSVFFLPKWTGVLKPKVFTEDYARYMRHLVDD-HHEPTKGDL---INQLQHFQLS 277
               .||....:...       :||.|...|....::..:.|: ..:.|..|:   :|.:..|   
plant   227 VKARRKAAKLLKAL-------ILKKKASKEGLGDFLDIIFDEMEKDGTALDIDKAVNLIFVF--- 281

  Fly   278 RSSNHYSQHPDFVASQAGIILLAGFETSSALMGFTLYELAKAPDIQERLRSELREAFISTAT--- 339
                       |:.||         ||:..:.|..:..:|..|.:.|.|:.| .||.:....   
plant   282 -----------FILSQ---------ETTPGVQGAVVKLVADHPSVMEELQRE-HEAIVQNRADKD 325

  Fly   340 --LSYDTLMTLPYLKMVCLEALRLYPAAAFVNRECTSSASEGFSLQPHVDFIVPPGMPAYISILG 402
              ::::...::.:..||..|:||.......|:|........|       |:.:|.|. .:..|..
plant   326 TGVTWEEYKSMTFTHMVIKESLRFTSTQPTVHRIPDQDVQIG-------DYTLPAGW-LFFGIPQ 382

  Fly   403 LHRDERFWPEPCVFDPERFGPERSRHIHPMTYIPFGAGPHGCIGSRLGVLQLKLGIVHILKQYWV 467
            :|.||..:.:|..|:|.|:..:.........|:|||||...|:||....|.:.:.:.|:.:..| 
plant   383 VHFDEEKYDDPLTFNPWRWQGKDINSTVSREYMPFGAGGTHCVGSEFAKLIIAILLHHLSRFRW- 446

  Fly   468 ETCERTVSEIRFNPKSFMLESENEIYLRFC 497
                      ..:||:.:|.....::...|
plant   447 ----------SLDPKTEVLRRYTLVFPAGC 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 103/512 (20%)
CYP702A3NP_193266.2 p450 35..458 CDD:386267 105/517 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.