DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t3 and CYP94D2

DIOPT Version :9

Sequence 1:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_191222.1 Gene:CYP94D2 / 824830 AraportID:AT3G56630 Length:499 Species:Arabidopsis thaliana


Alignment Length:450 Identity:98/450 - (21%)
Similarity:173/450 - (38%) Gaps:105/450 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 IFQTPA----LMVRDPELIRQVLIKNFNNFLNRFESADAGDPMGALTLPL-----------AKYH 126
            ||:.|.    :|..:|..:..:|...|.:|           |.|...:.:           :...
plant    67 IFRRPGKLQFVMTANPANVEYMLKTKFESF-----------PKGERFISILEDFLGRGIFNSDGE 120

  Fly   127 HWKESRQCMSQLFTSGRMRD-VMYSQMLDVASDL-----EQYLNRK---LGDRLERVLPLGRMCQ 182
            .|.:.|:..|..|::..:|| ||.:..:::.:.|     |...|.|   |.|.||| .....:|:
plant   121 MWWKQRKTASYEFSTKSLRDFVMSNVTVEINTRLVPVLAEAATNGKLIDLQDILER-FAFDNICK 184

  Fly   183 L-YTTD--------VTG-NLFYSLNVGGL---RRGRSEL--ITKTKELFNTNPRKVLDFMSVFFL 232
            | :..|        ..| |...:......   :|.:|.:  ..|.|:..|....:||. .|:..:
plant   185 LAFNVDSACLGDDGAAGVNFMQAFETAATIISQRFQSVISYSWKIKKKLNIGSERVLR-ESIMIV 248

  Fly   233 PKWTGVLKPKVFTEDYA--RYMRHLVDDHHEPTKGDLINQLQHFQLSRSSNHYSQHPDFVASQAG 295
            .|         |.::..  |..:..|.||.|    ||:::.       .|......|:.:.....
plant   249 HK---------FADEIVRNRIEQGKVSDHKE----DLLSRF-------ISKEEMNSPEILRDIVI 293

  Fly   296 IILLAGFETSSALMGFTLYELAKAPDIQERLRSELREAFISTA-----TLSYDTLMTLPYLKMVC 355
            ..:|||.:|:|:.:.:..:.|:..|::::::..||......|.     ...::.|..:.||....
plant   294 SFILAGRDTTSSALSWFFWLLSMHPEVKDKILQELNSIRERTGKRIGEVYGFEDLKLMNYLHAAI 358

  Fly   356 LEALRLYPAAAFVNRECTSSASEGFSLQPHVDFIVPPGMPAYI--------SILGLHRDERFWPE 412
            .|:|||||........|..            |.::|.|  .:|        :...:.|.|..|.:
plant   359 TESLRLYPPVPVDTMSCAE------------DNVLPDG--TFIGKDWGISYNAYAMGRMESIWGK 409

  Fly   413 PC-VFDPERFGPERS---RHIHPMTYIPFGAGPHGCIGSRLGVLQLKLGIVHILKQYWVE 468
            .| .|||||:..|.:   |..:|..:..|.|||..|:|..:..:|:|..:..:|:::.||
plant   410 DCDRFDPERWIDETNGGFRGENPYKFPAFHAGPRMCLGKEMAYIQMKSIVAAVLERFVVE 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 97/449 (22%)
CYP94D2NP_191222.1 p450 52..499 CDD:299894 97/449 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.