DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t3 and CYP704A2

DIOPT Version :9

Sequence 1:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_182075.1 Gene:CYP704A2 / 819159 AraportID:AT2G45510 Length:511 Species:Arabidopsis thaliana


Alignment Length:453 Identity:96/453 - (21%)
Similarity:165/453 - (36%) Gaps:115/453 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 FQTPA---LMVRDPELIRQVLIKNFNNFLNRFESAD-AGDPMGALTLPLAKYH--------HWKE 130
            |.:|.   ::..||..:..:|...|:|:.....|.: ..|.:|         |        .|::
plant    73 FLSPGQSEILTADPRNVEHILKTRFDNYSKGHSSRENMADLLG---------HGIFAVDGEKWRQ 128

  Fly   131 SRQCMSQLFTSGRMRDVMYSQMLDVASDL-----EQYLNRKLGD--------RLERVLPLGRMCQ 182
            .|:..|..|::..:||...|.....||.|     |..|:.|..|        .|:.:..:|...:
plant   129 QRKLSSFEFSTRVLRDFSCSVFRRNASKLVGFVSEFALSGKAFDAQDLLMRCTLDSIFKVGFGVE 193

  Fly   183 LYTTDVTGNLFYSLNVGGLRRGRSELITKTKELFN-----TNPRKVLDFMSVFFLPKW------T 236
            |...|            |..:...|.:    |.|:     |:.|    |:...:..||      .
plant   194 LKCLD------------GFSKEGQEFM----EAFDEGNVATSSR----FIDPLWKLKWFFNIGSQ 238

  Fly   237 GVLKPKVFTEDYARY------MRHLVDDHHEPTKGDLINQLQHFQLSRSSNHYSQHPDFVASQAG 295
            ..||..:.|.|...|      .:.|..:.:...:.|:   |..|.:....:..:.:..::.....
plant   239 SKLKKSIATIDKFVYSLITTKRKELAKEQNTVVREDI---LSRFLVESEKDPENMNDKYLRDIIL 300

  Fly   296 IILLAGFETSSALMGFTLYELAKAPDIQERLRSELREAFIS----------TATLSYDTLMTLPY 350
            ..::||.:|::||:.:.||.|.|.|.:||::..|:|:...|          ..:::.:.|..:.|
plant   301 NFMIAGKDTTAALLSWFLYMLCKNPLVQEKIVQEIRDVTFSHEKTTDVNGFVESINEEALDEMHY 365

  Fly   351 LKMVCLEALRLYPAAAFVNRECTSSASEGFSLQPHVDFIVPPGMPA------YISILGLHRDERF 409
            |.....|.|||||... |:..|..:           |.::|.|...      |.....:.|....
plant   366 LHAALSETLRLYPPVP-VDMRCAEN-----------DDVLPDGHRVSKGDNIYYIAYAMGRMTYI 418

  Fly   410 WPEPCVFDPERFGPER------SRHIHPMTYIPFGAGPHGCIGSRLGVLQLK---LGIVHILK 463
            |.:    |.|.|.|||      .:...|..:|.|.|||..|:|......|:|   :.::|..:
plant   419 WGQ----DAEEFKPERWLKDGLFQPESPFKFISFHAGPRICLGKDFAYRQMKIVSMALLHFFR 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 96/453 (21%)
CYP704A2NP_182075.1 PLN03195 15..509 CDD:215627 96/453 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.