DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t3 and CYP704A1

DIOPT Version :9

Sequence 1:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_850427.2 Gene:CYP704A1 / 819098 AraportID:AT2G44890 Length:511 Species:Arabidopsis thaliana


Alignment Length:503 Identity:112/503 - (22%)
Similarity:174/503 - (34%) Gaps:169/503 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 DLF---RQLYADPRNGQAKIVGFFIFQTPA---LMVRDPELIRQVLIKNFNNFLNRFESADAGDP 114
            |||   .:|| |.....|:....|.|.:|.   :...||..:..:|...|:|:        :..|
plant    49 DLFFHSHKLY-DYETEIARTKPTFRFLSPGQSEIFTADPRNVEHILKTRFHNY--------SKGP 104

  Fly   115 MGALTLPLAKYH--------HWKESRQCMSQLFTSGRMRDVMYSQMLDVASDL-----EQYLNRK 166
            :|.:.|.....|        .||:.|:.:|..|::..:|:..||.....||.|     |..|:.|
plant   105 VGTVNLADLLGHGIFAVDGEKWKQQRKLVSFEFSTRVLRNFSYSVFRTSASKLVGFIAEFALSGK 169

  Fly   167 LGD--------RLERVLPLGRMCQL--------------------------YTTDVTGNLFYSLN 197
            ..|        .|:.:..:|...:|                          ..||....|...||
plant   170 SFDFQDMLMKCTLDSIFKVGFGVELGCLDGFSKEGEEFMKAFDEGNGATSSRVTDPFWKLKCFLN 234

  Fly   198 VGGLRRGR-----------SELITKTKELF---NTNPRKVLDFMSVFFLPKWTGVLKPKVFTEDY 248
            :|...|.:           |.:.||.|||.   ||:.|:  |.:|.|.|   .....|:...:.|
plant   235 IGSESRLKKSIAIIDKFVYSLITTKRKELSKEQNTSVRE--DILSKFLL---ESEKDPENMNDKY 294

  Fly   249 ARYMRHLVDDHHEPTKGDLINQLQHFQLSRSSNHYSQHPDFVASQAGIILLAGFETSSALMGFTL 313
            .|                                     |.:.:    :::||.:|::|.:.:.|
plant   295 LR-------------------------------------DIILN----VMVAGKDTTAASLSWFL 318

  Fly   314 YELAKAPDIQERLRSELRE------------AFISTATLSYDTLMTLPYLKMVCLEALRLYPAAA 366
            |.|.|.|.:||::..|:|:            .||.:.|  .:.|..:.||.....|.:||||...
plant   319 YMLCKNPLVQEKIVQEIRDVTSSHEKTTDVNGFIESVT--EEALAQMQYLHAALSETMRLYPPVP 381

  Fly   367 FVNRECTSSASEGFSLQPHVDFIVPPGMPA-------YISILGLHRDERFWPEPCVFDPERFGPE 424
             .:..|..:           |.::|.|...       ||| ..:.|....|.:    |.|.|.||
plant   382 -EHMRCAEN-----------DDVLPDGHRVSKGDNIYYIS-YAMGRMTYIWGQ----DAEEFKPE 429

  Fly   425 R---SRHIHP---MTYIPFGAGPHGCIGSRLGVLQLK---LGIVHILK 463
            |   .....|   ..:|.|.|||..|||......|:|   :.::|..:
plant   430 RWLKDGVFQPESQFKFISFHAGPRICIGKDFAYRQMKIVSMALLHFFR 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 112/503 (22%)
CYP704A1NP_850427.2 CYP86A 69..501 CDD:410687 105/482 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.