DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t3 and CYP94C1

DIOPT Version :9

Sequence 1:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_180337.1 Gene:CYP94C1 / 817315 AraportID:AT2G27690 Length:495 Species:Arabidopsis thaliana


Alignment Length:448 Identity:98/448 - (21%)
Similarity:174/448 - (38%) Gaps:93/448 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 ALMVRDPELIRQVLIKNFNNF-LNRFESADAGDPMGALTLPLAKYHHWKESRQCMS--------Q 137
            :::..:|..:..:|..||:|: ..:..|...||.:|. .:..:....|:..|:..|        :
plant    75 SVITANPSNVEHILKTNFHNYPKGKQFSVILGDLLGR-GIFNSDGDTWRFQRKLASLELGSVSVR 138

  Fly   138 LFTSGRMRDVMYSQMLDVASDLEQYLNRKLGDRLERVLPLGRMCQLYTTDVTGNLFYSLNVGGLR 202
            :|....::..:.:::|.:.:        ...|....||.|..:.:.::.|....|.:..:...||
plant   139 VFAHEIVKTEIETRLLPILT--------SFSDNPGSVLDLQDVFRRFSFDTISKLSFGFDPDCLR 195

  Fly   203 ---------------------RGRS--ELITKTKELFNTNPRKVLDFMSVFFLPKWTGVLKPKVF 244
                                 |..:  .|:.|||.|......|.|. .|:..:.:..|.|..:  
plant   196 LPFPISEFAVAFDTASLLSAKRALAPFPLLWKTKRLLRIGSEKKLQ-ESINVINRLAGDLIKQ-- 257

  Fly   245 TEDYARYMRHLVDDHHEPTKGDLINQLQHFQLSRSSNHYSQHPDFVASQAGIILLAGFETSSA-L 308
                 |.:..|:.      |.|||::.... ::...:.|.:  |.|.|    .||||.:|.:| |
plant   258 -----RRLTGLMG------KNDLISRFMAV-VAEDDDEYLR--DIVVS----FLLAGRDTVAAGL 304

  Fly   309 MGFTLYELAKAPDIQERLRSELREAF---ISTATLSYDTLMTLPYLKMVCLEALRLYPAAAFVNR 370
            .|| .:.|.:.|:::.|:|.||....   ..:.|...|.:..:.||.....|::||:|...|.::
plant   305 TGF-FWLLTRHPEVENRIREELDRVMGTGFDSVTARCDEMREMDYLHASLYESMRLFPPVQFDSK 368

  Fly   371 ECTSSASEGFSLQPHV---DFIVPPGMPAYISILGLHRDERFW-PEPCVFDPER-------FGPE 424
                     |:|...|   ...|..|.........:.|.:|.| |:...|.|||       |.||
plant   369 ---------FALNDDVLSDGTFVNSGTRVTYHAYAMGRMDRIWGPDYEEFKPERWLDNEGKFRPE 424

  Fly   425 RSRHIHPMTYIPFGAGPHGCIGSRLGVLQLKLGIVHILKQYWVETCE-RTVSEIRFNP 481
                 :|:.|..|.||...|||..:.::::|...|.|::::...... .|...:||.|
plant   425 -----NPVKYPVFQAGARVCIGKEMAIMEMKSIAVAIIRRFETRVASPETTETLRFAP 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 98/448 (22%)
CYP94C1NP_180337.1 PLN02426 23..495 CDD:215235 98/448 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.