DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t3 and CYP711A1

DIOPT Version :9

Sequence 1:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_565617.2 Gene:CYP711A1 / 817157 AraportID:AT2G26170 Length:522 Species:Arabidopsis thaliana


Alignment Length:514 Identity:118/514 - (22%)
Similarity:213/514 - (41%) Gaps:96/514 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LLIWLLLLTIVTLNFWLRHKYDYFRSRG------IPHLPPSSWSPMGNLGQLLF--LRISFGDLF 58
            |:.:|....:|.:.:..|..:......|      :.|||     .|...|..:|  |...:|.:|
plant    21 LIAFLTFAAVVIVIYLYRPSWSVCNVPGPTAMPLVGHLP-----LMAKYGPDVFSVLAKQYGPIF 80

  Fly    59 RQLYADPRNGQAKIVGFFIFQTPALMVRDPELIRQVLIKNFNNFLNR-FESADAGDPMGALTLPL 122
            |               |.:.:.|.:::.:.||.|:|.||.|.:..|| ..|..:..|:....|..
plant    81 R---------------FQMGRQPLIIIAEAELCREVGIKKFKDLPNRSIPSPISASPLHKKGLFF 130

  Fly   123 AKYHHWKESRQCMSQLFTSGRMRDV---MYSQMLDVASDLEQYLNRKLGDRLERVLPLGRMCQLY 184
            .:...|.:.|..:..|:....:..:   |:|.:.....:|         |...|.:....:....
plant   131 TRDKRWSKMRNTILSLYQPSHLTSLIPTMHSFITSATHNL---------DSKPRDIVFSNLFLKL 186

  Fly   185 TTDVTGNLFYSLNVG--GLRRGRSELITK--TKELFNTNPRKVLDF---MSVFFLPKWTGVLKPK 242
            |||:.|...:.::.|  |.:..:...:|.  .:.:::|...| :|.   :|:..     |:|.| 
plant   187 TTDIIGQAAFGVDFGLSGKKPIKDVEVTDFINQHVYSTTQLK-MDLSGSLSIIL-----GLLIP- 244

  Fly   243 VFTEDYARYMRHL---VDDHHEPTKGDLINQLQH-------------------FQLSRSSNHYSQ 285
            :..|.:.:.::.:   :|...|.|...|..||..                   ...:|.|:.:::
plant   245 ILQEPFRQVLKRIPGTMDWRVEKTNARLSGQLNEIVSKRAKEAETDSKDFLSLILKARESDPFAK 309

  Fly   286 H---PDFVASQAGIILLAGFETSSALMGFTLYELAKAPDIQERLRSEL----REAFISTATLSYD 343
            :   .|::::.....||||..|::..:...||.::...|:::||..|:    ....|.||   :|
plant   310 NIFTSDYISAVTYEHLLAGSATTAFTLSSVLYLVSGHLDVEKRLLQEIDGFGNRDLIPTA---HD 371

  Fly   344 TLMTLPYLKMVCLEALRLYPAAAFVNRECTSSASEGFSLQPHVDFIVPPGMPAYISILGLHRDER 408
            .....|||..|..||:|.|..:..|.||.......|       .:::|.|...::::..|.:|.:
plant   372 LQHKFPYLDQVIKEAMRFYMVSPLVARETAKEVEIG-------GYLLPKGTWVWLALGVLAKDPK 429

  Fly   409 FWPEPCVFDPERFGP--ERSRHIHPMTYIPFGAGPHGCIGSRLGVLQLKLGIVHILKQY 465
            .:|||..|.||||.|  |..:|.||..:||||.||..|:|.|..:.::||.::|:.:.|
plant   430 NFPEPEKFKPERFDPNGEEEKHRHPYAFIPFGIGPRACVGQRFALQEIKLTLLHLYRNY 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 111/476 (23%)
CYP711A1NP_565617.2 cytochrome_P450 75..515 CDD:425388 106/455 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 151 1.000 Domainoid score I1386
eggNOG 1 0.900 - - E2759_KOG0158
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I1621
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 1 1.000 - - otm3438
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X40
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.