DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t3 and CYP96A5

DIOPT Version :9

Sequence 1:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_179782.1 Gene:CYP96A5 / 816727 AraportID:AT2G21910 Length:510 Species:Arabidopsis thaliana


Alignment Length:524 Identity:110/524 - (20%)
Similarity:195/524 - (37%) Gaps:96/524 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLIWLLLLTIVTLNFWLRHKYDYFRSRGIPHLPPSSWSPMGNLGQLLFLRISFGDLFRQLYADP 65
            |..:.|:.:.|..|.|:..|...:.:|.   .:.|.:|..:|.|..:|.:.....|...::    
plant     1 MAYVGLVEVFIALLVFFFFHFLIHKKSH---QITPRNWPVLGMLPGVLVMLHRINDYVAEI---- 58

  Fly    66 RNGQAKIVGF-FIFQTP------ALMVRDPELIRQVLIKNFNNFLNRFESADAGDPMGALTLPLA 123
                .::... |.|:.|      .|:..||..|:.|...||:|:....|..:..|.:|. .:..|
plant    59 ----LEVSNLTFAFKGPWFSGMNMLITADPSNIQHVFSSNFSNYDKGPEFKEMFDFLGN-GIFTA 118

  Fly   124 KYHHWKESRQ-----CMSQLFTSGRMRDVMYS------QMLD------VASDLEQYLNRKLGDRL 171
            ....|::.|:     ...|.|.|..:|.:...      .:||      ...||:....|...|  
plant   119 DSKLWEDMRKSALVVLSHQGFQSFSLRTITCKIKNGLVPVLDHFAEANTVFDLQDVFQRLAFD-- 181

  Fly   172 ERVLPLGRMCQLYTTDVTGNLFYSLNVGGLRRGRSELITKTKELF---NTNPRKVLDFMSVFFLP 233
                       :..|.|||....||::...:...::.:...:|:.   :..|      :.::.|.
plant   182 -----------VTLTLVTGCDSSSLSIEMPKNEYAKAMDDAEEVVVYRHVKP------VVLWKLQ 229

  Fly   234 KWTGVLKPK-------VFTEDYARYM---RHLVDDHHEPTKG-----DLINQLQHFQLSRSSNHY 283
            .|.|:.:.|       .|....|:|:   |..:..||....|     ||::...:..:|:.....
plant   230 NWIGLGEEKKMKEANAAFDRSCAKYISAKREEIISHHSNIGGEAHAEDLLSVYMNLDISKYELLN 294

  Fly   284 SQHPDFVASQAGIILLAGFETSSALMGFTLYELAKAPDIQERLRSELREAFI-STATLSYDTLMT 347
            ....:|:.......:|||.:..:..:.:..:.|:|.|:...::|.|:..... |..:|..|.|..
plant   295 PNDDNFLKDIIKSFMLAGRDAIATTLTWFFWLLSKNPEAVTKIRQEINTNLPGSGMSLDADKLNK 359

  Fly   348 LPYLKMVCLEALRLYPAAAFVNRECTSSASEGFSLQPHVDFIVPPG------MPAYISILGLHRD 406
            :.||.....|:||||....|..:            .|....::|.|      .....|:..|.|.
plant   360 MVYLHGALCESLRLYAPIPFERK------------TPIKQDVLPSGHMVDKNWKILFSVYALGRM 412

  Fly   407 ERFW-PEPCVFDPERFGPERS---RHIHPMTYIPFGAGPHGCIGSRLGVLQLKLGIVHILKQYWV 467
            ...| .:...|.|||:..||:   :|.....:..|.:||..|:|..|..||:|...|.|::.|.:
plant   413 RSVWGQDASEFKPERWISERNGGLKHEPSFKFFVFNSGPRNCLGKNLSFLQMKTVAVEIIRNYDI 477

  Fly   468 ETCE 471
            :..|
plant   478 KVVE 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 103/491 (21%)
CYP96A5NP_179782.1 p450 1..506 CDD:299894 110/524 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.