DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t3 and CYP4F12

DIOPT Version :9

Sequence 1:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_076433.3 Gene:CYP4F12 / 66002 HGNCID:18857 Length:524 Species:Homo sapiens


Alignment Length:552 Identity:134/552 - (24%)
Similarity:228/552 - (41%) Gaps:116/552 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WLLLLTIVTLNFWLRHK-----YDYF----RSRGIPHLPPSSWSPMGNLGQLL----FLRISFGD 56
            |||||.:|  ..||..:     |.::    |.:..|..|..:|. .|:||.:.    .|:.|   
Human    19 WLLLLLVV--GSWLLARILAWTYAFYNNCRRLQCFPQPPKRNWF-WGHLGLITPTEEGLKNS--- 77

  Fly    57 LFRQLYADPRNGQAKIVGFFIFQTPALMVRDPELIRQV-----LIKNFNNFLNRFESADAGDPMG 116
              .|:.|....|....:|..|   |.:::..|:.||.:     .|...:|...||.....|:  |
Human    78 --TQMSATYSQGFTVWLGPII---PFIVLCHPDTIRSITNASAAIAPKDNLFIRFLKPWLGE--G 135

  Fly   117 ALTLPLAKYHHWKESRQCMSQLFTSGRMRD--VMYSQMLDVASDLEQYLNRKLGDRLERVLPLGR 179
            .|   |:....|...|:.::..|....::.  .::::..::..|..|:|..:...||:    :..
Human   136 IL---LSGGDKWSRHRRMLTPAFHFNILKSYITIFNKSANIMLDKWQHLASEGSSRLD----MFE 193

  Fly   180 MCQLYTTDVTGNLFYSLNVGGLRRGRSELITKTKE---LFNTNPRKVLDFMSVFFLPKWTGVLKP 241
            ...|.|.|......:|.: ...:...||.|....|   |.....:.:|..|...:          
Human   194 HISLMTLDSLQKCIFSFD-SHCQERPSEYIATILELSALVEKRSQHILQHMDFLY---------- 247

  Fly   242 KVFTEDYARYMR--HLVDDHHE----------PTKG--------------DLINQLQHFQLSRSS 280
             ..:.|..|:.|  .||.|..:          ||:|              |.|:.|   .||:..
Human   248 -YLSHDGRRFHRACRLVHDFTDAVIRERRRTLPTQGIDDFFKDKAKSKTLDFIDVL---LLSKDE 308

  Fly   281 NHYSQHPDFVASQAGIILLAGFETSSALMGFTLYELAKAPDIQERLRSELREAF--ISTATLSYD 343
            :..:...:.:.::|...:..|.:|:::.:.:.||.||:.|:.|||.|.|::|..  .....:.:|
Human   309 DGKALSDEDIRAEADTFMFGGHDTTASGLSWVLYNLARHPEYQERCRQEVQELLKDRDPKEIEWD 373

  Fly   344 TLMTLPYLKMVCLEALRLYPAAAFVNRECTSS--ASEGFSLQPHVDFIVPPGMPAYISILGLHRD 406
            .|..||:|.|...|:|||:|.|.|::|.||..  ..:|        .::|.|:...|.|:|:|.:
Human   374 DLAQLPFLTMCVKESLRLHPPAPFISRCCTQDIVLPDG--------RVIPKGITCLIDIIGVHHN 430

  Fly   407 ERFWPEPCVFDPERFGPERSRHIHPMTYIPFGAGPHGCIGSRLGVLQLKLGIVHILKQYWVETCE 471
            ...||:|.|:||.||.||.|:...|:.:|||.|||..|||....:.::|:.:..:|..:      
Human   431 PTVWPDPEVYDPFRFDPENSKGRSPLAFIPFSAGPRNCIGQAFAMAEMKVVLALMLLHF------ 489

  Fly   472 RTVSEIRFNPK--------SFMLESENEIYLR 495
                  ||.|.        ..::.:|..::||
Human   490 ------RFLPDHTEPRRKLELIMRAEGGLWLR 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 120/503 (24%)
CYP4F12NP_076433.3 p450 52..506 CDD:306555 121/506 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.