DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t3 and cyp19a1b

DIOPT Version :9

Sequence 1:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster
Sequence 2:XP_021326198.1 Gene:cyp19a1b / 60640 ZFINID:ZDB-GENE-001103-4 Length:513 Species:Danio rerio


Alignment Length:532 Identity:119/532 - (22%)
Similarity:199/532 - (37%) Gaps:137/532 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLLLTIVTLNFWLRHKYDYFRSRGIPHLPPSSW----SPMGNLGQLLFLRI---------SFGDL 57
            |||||...:...|...:.....|....||...|    .|:.:..:.|::.|         .:|.:
Zfish    20 LLLLTGTLMLILLHRIFGVKNWRNQSALPGPGWWLGLGPVLSYSRFLWMGIGTACNYYNEKYGSI 84

  Fly    58 FRQLYADPRNGQAKIVGFFIFQTPALMVRDPELIRQV------LIKNFNNFLNRFESADAGDPMG 116
            .|...    ||:..::                |.:||      ::|: ||:..||.||.....:|
Zfish    85 ARVWI----NGEETVI----------------LSKQVSSAVYHVLKS-NNYTGRFASAKGLQCIG 128

  Fly   117 ------ALTLPLAKYHHWKESRQCMSQLFTS-GRMRDV-----MYSQMLDV------ASDLEQYL 163
                  .....:||   ||:.|...::..|. |..:.|     ..::.|||      ||.....|
Zfish   129 MFEQGIIFNSNIAK---WKKVRTYFTKALTGPGLQKSVEVCVSATNRQLDVLQEFTDASGHVDVL 190

  Fly   164 NRKLGDRLERVLPLGRMCQLYTTDVTGNLFYSLNVGGLRRGRSELITKTKELFNTNPRKVLDFMS 228
            |               :.:....||:..||..:.:     ...||:.|....|:|          
Zfish   191 N---------------LLRCIVVDVSNRLFLRIPL-----NEKELLIKIHRYFST---------- 225

  Fly   229 VFFLPKW-TGVLKPKVFTE-DYARYMRHLVDDHHEPTKGDLINQLQH--------------FQLS 277
                  | |.:::|.:|.: |:.....||.....:...|.|:.|.:.              .:|.
Zfish   226 ------WQTVLIQPDIFFKLDFVYRKYHLAAKELQDEMGKLVEQKRQAINNTEKLDEMDFATELI 284

  Fly   278 RSSNHYSQHPDFVASQAGIILLAGFETSSALMGFTLYELAKAPDIQERLRSELREAFISTATLSY 342
            .:.||.....|.|......:::|..:|.|..:.|.|..|.:...::|::..|::....|....|.
Zfish   285 FAQNHDELSVDDVRQCVLEMVIAAPDTLSISLFFMLLLLKQNSAVEEQIVQEIQSQIGSRDVESA 349

  Fly   343 DTLMTLPYLKMVCLEALRLYPAAAFVNRECTSSASEGFSLQ-PHVD-FIVPPGMPAYISILGLHR 405
            | |..|..|:....|:||.:|...|:.|:         ||: .::| :.|..|....::|..:|:
Zfish   350 D-LQKLNVLERFIKESLRYHPVVDFIMRQ---------SLEDDYIDGYRVAKGTNLILNIGRMHK 404

  Fly   406 DERFWPEPCVFDPERFGPERSRHIHPMTYI-PFGAGPHGCIGSRLGVLQLKLGIVHILKQYWVET 469
            .| |:.:|..|..|.|     .:..|..|. |||.||..|:|..:.::..|..:|.:|.::.|  
Zfish   405 TE-FFKKPNEFSLENF-----ENTVPSRYFQPFGCGPRACVGKHIAMVMTKAILVTMLSRFTV-- 461

  Fly   470 CER---TVSEIR 478
            |.|   |:|.||
Zfish   462 CPRHGCTISTIR 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 111/504 (22%)
cyp19a1bXP_021326198.1 p450 48..482 CDD:306555 111/504 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.