DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t3 and cyp4f2

DIOPT Version :9

Sequence 1:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001016020.1 Gene:cyp4f2 / 548774 XenbaseID:XB-GENE-6258041 Length:528 Species:Xenopus tropicalis


Alignment Length:559 Identity:135/559 - (24%)
Similarity:233/559 - (41%) Gaps:127/559 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLIWLLLL--TIVTLNFWLRHKYDYF----RSRGIPHLPPSSWSPMGNLGQLLFLRISFG---- 55
            ::|::.|::  ||..:..::   |.|.    |.|..|..|..||. :|:||  :|:....|    
 Frog    27 VILMFCLIMCRTIFKMAIYI---YAYIINARRLRCFPEPPRRSWL-LGHLG--MFMPTEEGLTEI 85

  Fly    56 -----DLFRQLYADPRNGQAKIVGFFIFQTPALMVRDPELIRQVLIKN---------FNNFLNRF 106
                 :|.|.|..            ::...|.:.:..|:.::.|:..:         |..||..:
 Frog    86 SSAICNLRRTLLT------------WLGPIPEVSLVHPDTVKPVVAASAAIAPKDELFYGFLRPW 138

  Fly   107 ESADAGDPMGALTLPLAKYHHWKESRQCMSQLFTSGRMRDVMYSQMLDVASDLEQYLNRKLG--- 168
                .||  |.|   |::...|.:.|:.::..|....:::  |.::.:.::|:.....|:|.   
 Frog   139 ----LGD--GLL---LSRGEKWGQHRRLLTPAFHFDILKN--YVKIFNQSTDIMLAKWRRLTAEG 192

  Fly   169 ----DRLERV--LPLGRM----------CQLYTTDVTGNLFYSLNVGGLRRGRSELITKTKE--- 214
                |..|.|  :.|..:          ||...:|.. :..|.|         |.|:.|.:.   
 Frog   193 PVSLDMFEHVSLMTLDTLLKCTFSYDSDCQEKPSDYI-SAIYEL---------SSLVVKREHYLP 247

  Fly   215 -----LFN--TNPRK-------VLDFMSVFFLPKWTGVL--KPKVFTEDYARYMRHLVDDHHEPT 263
                 ::|  :|.||       |.:|.:        ||:  :.|...|   :.|...:......|
 Frog   248 HHFDFIYNLSSNGRKFRQACKTVHEFTA--------GVVQQRKKALQE---KGMEEWIKSKQGKT 301

  Fly   264 KGDLINQLQHFQLSRSSNHYSQHPDFVASQAGIILLAGFETSSALMGFTLYELAKAPDIQERLRS 328
            | |.|:.|   .||::.:......:.:.::....:..|.:|:::.:.:.||.||..|:.||:.|.
 Frog   302 K-DFIDIL---LLSKNEDGSQLSDEDMRAEVDTFMFEGHDTTASGLSWILYNLACHPEYQEKCRK 362

  Fly   329 ELREAF--ISTATLSYDTLMTLPYLKMVCLEALRLYPAAAFVNRECTSSASEGFSLQPHVDFIVP 391
            |:.|..  .....|.:|.|..||:..|...|:|||:|....|.|.||    |...| |..| |:|
 Frog   363 EITELLEGKDIKHLEWDELSKLPFTTMCIKESLRLHPPVVAVIRRCT----EDIKL-PKGD-ILP 421

  Fly   392 PGMPAYISILGLHRDERFWPEPCVFDPERFGPERSRHIHPMTYIPFGAGPHGCIGSRLGVLQLKL 456
            .|....|:|.|:|.:...||.|.|:||.||.||..:......::||.|||..|||....:.::|:
 Frog   422 KGNCCIINIFGIHHNPDVWPNPQVYDPYRFDPENLQERSSYAFVPFSAGPRNCIGQNFAMAEMKI 486

  Fly   457 GIVHILKQYWVETCERTVSEIRFNPKSFMLESENEIYLR 495
            .:..||..:.|...|  ...:|..|: .:|.:||.::|:
 Frog   487 VLALILYNFQVRLDE--TKTVRRKPE-LILRAENGLWLQ 522

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 122/509 (24%)
cyp4f2NP_001016020.1 p450 60..513 CDD:278495 123/512 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.