DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t3 and cyp3a4.2

DIOPT Version :9

Sequence 1:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001015786.1 Gene:cyp3a4.2 / 548503 XenbaseID:XB-GENE-971750 Length:504 Species:Xenopus tropicalis


Alignment Length:533 Identity:156/533 - (29%)
Similarity:246/533 - (46%) Gaps:89/533 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WLLLLTIVTL----NFWLRHKYDYFRSRGIPHLPPSSWSPMGNLGQLLFLR---ISFG-DLFRQL 61
            |:||..::.|    ..|   .|.||:..|||     ..:|:..:|..|..|   :.|. :.|:: 
 Frog    12 WILLAALLVLILLYGIW---PYGYFKKMGIP-----GPTPLPFIGTFLEFRKGMVQFDTECFKK- 67

  Fly    62 YADPRNGQAKIVGFFIFQTPALMVRDPELIRQVLIKN-FNNFLNR--------FESADAGDPMGA 117
                   ..|:.|.:..:.|.|.:.||.:|:.:|:|. :.||.||        ||||        
 Frog    68 -------YGKMWGTYDGRQPVLAIMDPAIIKTILVKECYTNFTNRRNFGLNGPFESA-------- 117

  Fly   118 LTLPLAKYHHWKESRQCMSQLFTSGRMRDVMYSQMLDVASDLEQYLNRKLGDRLERVLPLGR--M 180
              :.:|:...||..|..:|..||||:::     :|..:..|....|.:.:...:|:..|...  :
 Frog   118 --ITIAEDEQWKRIRNVLSPTFTSGKLK-----EMFQIMKDYSDILVKNIQGYVEKDEPCATKDV 175

  Fly   181 CQLYTTDVTGNLFYSLNVGGLRRGRSELITKTKELFNT---NPRKVLDFMSVFFLPKWTGV---L 239
            ...|:.||..:..:|:|:..|.:.....:...|:|..|   :|..:|..:..|..|...|:   .
 Frog   176 IGAYSMDVITSTSFSVNIDSLNKPSDPFVIHMKKLLKTGLLSPLLILVVIFPFLRPILEGLNLNF 240

  Fly   240 KPKVFTEDYARYMRHLVDDHHEPTKGDLINQLQHFQL---SR-------SSNHYSQHPDFVASQA 294
            .||.|||   .:|..:.....:..|||...::...||   ||       |:.|.:.....:.:|:
 Frog   241 VPKDFTE---FFMNAVTSFREKRKKGDHSGRVDLLQLMMDSRTTGGNDLSNKHKALTDAEIMAQS 302

  Fly   295 GIILLAGFETSSALMGFTLYELAKAPDIQERLRSELREAFISTATLSYDTLMTLPYLKMVCLEAL 359
            .|.::||:||:|..:.:..|.||..||:|:||..|:.......|:.:||.||.:.||.||..|.|
 Frog   303 VIFIVAGYETTSTALSYLFYNLATHPDVQQRLHEEIDSFLPDKASPTYDILMQMEYLDMVIQETL 367

  Fly   360 RLYPAAAFVNRECTSSAS-EGFSLQPHVDFIVPPG----MPAYISILGLHRDERFWPEPCVFDPE 419
            ||:|.|..:.|....:.. .|.|        :|.|    :|||:    |.||..:||||..|.||
 Frog   368 RLFPPAGRLERVSKQNVEINGVS--------IPKGIVTLIPAYV----LQRDPEYWPEPEEFRPE 420

  Fly   420 RFGPE-RSRHIHPMTYIPFGAGPHGCIGSRLGVLQLKLGIVHILKQYWVETCERTVSEIRFNPKS 483
            ||..| |:.|. |.|::|||.||..|||.|..:|.:|:.||.:|:.:.|..|..|:..:.|:...
 Frog   421 RFSKENRATHT-PFTFLPFGDGPRNCIGLRFALLSMKVAIVTLLQNFSVRPCAETLIPMEFSTIG 484

  Fly   484 FMLESENEIYLRF 496
            | |:.:..|.|:|
 Frog   485 F-LQPKKPIVLKF 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 141/488 (29%)
cyp3a4.2NP_001015786.1 p450 39..496 CDD:365848 145/501 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X40
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.