DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t3 and Cyp2c67

DIOPT Version :9

Sequence 1:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001019890.1 Gene:Cyp2c67 / 545288 MGIID:3612288 Length:491 Species:Mus musculus


Alignment Length:513 Identity:101/513 - (19%)
Similarity:195/513 - (38%) Gaps:110/513 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LLIWLLLLTIVTLNFWLRHKYDYFRSRGIPHLPPSSWSPM---GN--------LGQLL--FLRIS 53
            :::.|.|..::.|:.|.:..     :||  :|||.. :|:   ||        :||.|  |.: :
Mouse     5 VVLVLCLSFLLVLSLWRQRS-----ARG--NLPPGP-TPLPIIGNYHLIDMKDIGQCLTNFSK-T 60

  Fly    54 FGDLFRQLYADPRNGQAKIVGFFIFQTPALMVRDPELIRQVLIKNFNNFLNR-----FESADAGD 113
            :|.:|.               .:....|.:::...|.:::..|.:...|..|     |:....|.
Mouse    61 YGPVFT---------------LYFGSQPIVVLHGYEAMKEAFIDHGEEFSGRGRFPFFDKVTKGK 110

  Fly   114 PMGALTLPLAKYHH---WKESRQCMSQLFTSGRMRDV------MYSQMLDVASDLEQYLNRKLGD 169
            .:|        :.|   ||.:|     :||...:|::      :.:::.:.|..|.:.|.:..|.
Mouse   111 GIG--------FSHGNVWKATR-----VFTINTLRNLGMGKRTIENKVQEEAQWLMKELKKTNGL 162

  Fly   170 RLERVLPLG-RMCQLYTTDVTGNL-------FYSLNVGGLRRGRSELITKTKELFNTNPRKVLDF 226
            ..:....:| ..|.:..:.|..|.       |.|| :|.:......|.:...::||..| .::|:
Mouse   163 PCDPQFIIGCAPCNVICSIVFQNRFDYKDKDFLSL-IGKVNECTEILSSPGCQIFNAVP-ILIDY 225

  Fly   227 M----SVFFLPKWTGVLKPKVFTEDYARYMRHLVDDHHEPTKGDLINQ---LQHFQLSRSSNHYS 284
            .    :.||        |...:.:.   |:...:.:|.|..  |:.|.   :.:|.:.|......
Mouse   226 CPGRHNKFF--------KNHTWIKS---YLLEKIKEHEESL--DVTNPRDFIDYFLIQRCQEKGI 277

  Fly   285 QHPDF----VASQAGIILLAGFETSSALMGFTLYELAKAPDIQERLRSELREAFISTATLSYDTL 345
            :|.::    :|:....::..|.|:.|:.|.|.|..|.|...|..:::.|:........:......
Mouse   278 EHMEYTIEHLATLVTDLVFGGTESLSSTMRFALLLLMKHTHITAKVQEEIDNVIGRHRSPCMQDR 342

  Fly   346 MTLPYLKMVCLEALR---LYPAAAFVNRECTSSASEGFSLQPHVDFIVPPGMPAYISILGLHRDE 407
            ..:||...:..|..|   |.|.:......|.:...         ::.:|.|.....|:..:..|.
Mouse   343 NHMPYTNAMVHEVQRYVDLGPISLVHEVTCDTKFR---------NYFIPKGTQVMTSLTSVLHDS 398

  Fly   408 RFWPEPCVFDPERFGPERSRHIHPMTYIPFGAGPHGCIGSRLGVLQLKLGIVHILKQY 465
            ..:|.|.||||..|..:.........::||.||...|:|..|..::|.|.:..||:.:
Mouse   399 TEFPNPEVFDPGHFLDDNGNFKKSDYFVPFSAGKRICVGESLARMELFLFLTTILQNF 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 94/481 (20%)
Cyp2c67NP_001019890.1 p450 30..487 CDD:278495 94/481 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.