DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t3 and Cyp4a1

DIOPT Version :9

Sequence 1:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_787031.1 Gene:Cyp4a1 / 50549 RGDID:68945 Length:509 Species:Rattus norvegicus


Alignment Length:549 Identity:124/549 - (22%)
Similarity:219/549 - (39%) Gaps:126/549 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LIWLLLLTIVTLNF-----WLRHKYDYFRSRGIPHLPPSSWSPMGNLGQLLFLRISF-GDL-FRQ 60
            ::.||||.:..:.|     ||...:..|.|      ||..|         .|....| ||. .:|
  Rat    24 VLGLLLLLVKAVQFYLQRQWLLKAFQQFPS------PPFHW---------FFGHKQFQGDKELQQ 73

  Fly    61 LYADPRNGQAKIVGFFIFQTPALMVRDPELIRQVLIKNFNNFLNRFESADAGDPMG----ALTLP 121
            :.....|..:....:|......|:|.||:.::.:|.::              ||..    .|..|
  Rat    74 IMTCVENFPSAFPRWFWGSKAYLIVYDPDYMKVILGRS--------------DPKANGVYRLLAP 124

  Fly   122 LAKY-------HHWKESRQCMSQLFTSGRMRDVMYSQMLDVASDLEQYLNRKLGDRLERV----- 174
            ...|       ..|.:.|:.::..|    ..|::...:.::|..:     |.:.|:.|::     
  Rat   125 WIGYGLLLLNGQPWFQHRRMLTPAF----HYDILKPYVKNMADSI-----RLMLDKWEQLAGQDS 180

  Fly   175 -LPLGRMCQLYTTDVTGNLFYSLN----VGGLRRGRSELITKTKELFNTNPRKVLDFMSVFFLPK 234
             :.:.:...|.|.|......:|.|    |.|..:...:.|....:||::..|.:.......:   
  Rat   181 SIEIFQHISLMTLDTVMKCAFSHNGSVQVDGNYKSYIQAIGNLNDLFHSRVRNIFHQNDTIY--- 242

  Fly   235 WTGVLKPKVFTEDYARYMR--HLVDDHHE----------PTKGDL--------INQLQHFQLSRS 279
                    .|:.:...:.|  .|..||.:          ...|:|        ::.|....|:|.
  Rat   243 --------NFSSNGHLFNRACQLAHDHTDGVIKLRKDQLQNAGELEKVKKKRRLDFLDILLLARM 299

  Fly   280 SNHYSQHPDFVASQAGIILLAGFETSSALMGFTLYELAKAPDIQERLRSELREAFISTATLSYDT 344
            .|..|.....:.::....:..|.:|:::.:.:..|.||..|:.|:|.|.|::......:::::|.
  Rat   300 ENGDSLSDKDLRAEVDTFMFEGHDTTASGVSWIFYALATHPEHQQRCREEVQSVLGDGSSITWDH 364

  Fly   345 LMTLPYLKMVCLEALRLYPAAAFVNRECTSSAS--EGFSLQPHVDFIVPPGMPAYISILGLHRDE 407
            |..:||..|...|||||||....:.||.::|.:  :|.||        |.|:...:||.|||.:.
  Rat   365 LDQIPYTTMCIKEALRLYPPVPGIVRELSTSVTFPDGRSL--------PKGIQVTLSIYGLHHNP 421

  Fly   408 RFWPEPCVFDPERFGPERSRHIHPMTYIPFGAGPHGCIGSRLGVLQLKLGIVHILKQYWVETCER 472
            :.||.|.||||.||.|:..||.|  :::||..|...|||.:..:.::|:.:...|.::       
  Rat   422 KVWPNPEVFDPSRFAPDSPRHSH--SFLPFSGGARNCIGKQFAMSEMKVIVALTLLRF------- 477

  Fly   473 TVSEIRFNPKS-------FMLESENEIYL 494
               |:..:|..       .:|:|:|.|||
  Rat   478 ---ELLPDPTKVPIPLPRLVLKSKNGIYL 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 109/503 (22%)
Cyp4a1NP_787031.1 p450 52..503 CDD:278495 114/519 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.