DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t3 and Cyp4f40

DIOPT Version :9

Sequence 1:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster
Sequence 2:XP_038935701.1 Gene:Cyp4f40 / 503122 RGDID:1559596 Length:530 Species:Rattus norvegicus


Alignment Length:571 Identity:136/571 - (23%)
Similarity:224/571 - (39%) Gaps:132/571 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LIWL----------LLLTIVTLNFW----LRHKYDYF----RSRGIPHLPPSSWSPMGNLGQLLF 49
            |.||          |||::|.::::    |...|..:    |..|.|..|..||. .|:||....
  Rat     6 LSWLGLGPMSASPWLLLSLVGVSWFLTRCLTQIYTLYAKCQRLCGFPQPPKRSWF-WGHLGMSPP 69

  Fly    50 LRISFGDLFRQLYADPRNGQAKIVGFFIFQ---TPALMVRDPELIRQVLIKN---------FNNF 102
            .......:...:...|:       ||..:.   .|.:.:..|::||.||..:         |.:|
  Rat    70 TEEGMKQMTELVATYPQ-------GFMTWLGPIVPLITLCHPDIIRSVLSASAAVAPKDGIFYSF 127

  Fly   103 LNRFESADAGDPMGALTLPLAKYHHWKESRQCMSQLFTSGRMR----------DVMYSQMLDVAS 157
            |..:    .||  |.|.....|   |...|..::..|....::          ::|:::.|.:||
  Rat   128 LKPW----LGD--GLLVSASDK---WSRHRSMLTPAFHFNILKPYVKIFNDSTNIMHAKWLRLAS 183

  Fly   158 DLEQYLNRKLGDRLERVLPLGRMCQLYTTDVTGNLFYSLNVGGLRRGRSELITKTKEL----FNT 218
            ....:|     |..|.:       .|.|.|......:|.| ...:...||.|....||    ...
  Rat   184 GGSAHL-----DMFENI-------SLMTLDTLQKCVFSFN-SNCQEKPSEYIAAILELSALVVKR 235

  Fly   219 NPRKVLDFMSVFFLPKWTGVLKPKVFTEDYARYMR--HLVDDH---------------------H 260
            |.:.:|....::.|            |.|..|:.:  |||.|.                     .
  Rat   236 NEQLLLHMDLLYRL------------TPDGRRFYKACHLVHDFTYAVIQERRRTLPKHGGDDVIK 288

  Fly   261 EPTKGDLINQLQHFQLSRSSNHYSQHPDFVASQAGIILLAGFETSSALMGFTLYELAKAPDIQER 325
            ...|...::.:....||:..:......:.:.::|...:..|.:|:::.:.:.||.|||.|:.|||
  Rat   289 AKAKSKTLDFIDVLLLSKDEDGKELSDEDIRAEADTFMFEGHDTTASGLSWILYNLAKHPEYQER 353

  Fly   326 LRSELREAF---------ISTATLSYDTLMTLPYLKMVCLEALRLYPAAAFVNRECTSSAS--EG 379
            .|.|::|..         .|...|..|.|..||:|.|...|:|||:|....|:|.||...|  :|
  Rat   354 CRQEVQELLRDRDSEEIECSCGVLLRDDLAQLPFLTMCIKESLRLHPPVTMVSRCCTQDISLPDG 418

  Fly   380 FSLQPHVDFIVPPGMPAYISILGLHRDERFWPEPCVFDPERFGPERSRHIHPMTYIPFGAGPHGC 444
                    .::|.|:...|:|...|.:...|.:|.|:||.||.||..:...|:.:|||.|||..|
  Rat   419 --------RVIPKGIICIINIFATHHNPTVWQDPEVYDPFRFDPENIQARSPLAFIPFSAGPRNC 475

  Fly   445 IGSRLGVLQLKLGIVHILKQYWVETCERTVSEIRFNPKSFMLESENEIYLR 495
            ||....:.::|:.:...|.::.|...::   |.|..|: .:|.:|:.::||
  Rat   476 IGQTFAMNEMKVAVALTLLRFRVLPDDK---EPRRKPE-LILRAEDGLWLR 522

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 120/511 (23%)
Cyp4f40XP_038935701.1 CYP4F 74..522 CDD:410772 116/500 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.