DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t3 and Cyp4f17

DIOPT Version :9

Sequence 1:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001178915.1 Gene:Cyp4f17 / 500801 RGDID:1561655 Length:524 Species:Rattus norvegicus


Alignment Length:536 Identity:136/536 - (25%)
Similarity:224/536 - (41%) Gaps:84/536 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WLLLLTIVT------LNFWLRHKYD-YFRSRGIPHLPPSSWSPMGNL--------GQLLFLRIS- 53
            |.|||.:.|      :..|:...|| |.|.|..|..|...|. .|:|        |..|...:| 
  Rat    19 WQLLLVVGTSLLLARILAWISAFYDNYCRLRCFPQPPSRHWF-WGHLNLVKNNEEGLQLLAEMSH 82

  Fly    54 -FGDL----FRQLYADPRNGQAKIVGFFIFQTPALMVRDPELIRQVLIKNFNNFLNRFESADAGD 113
             |.|:    ....|...|....|.:| .|.|.|| .|...|:|       |..||..:    .||
  Rat    83 QFQDIHLCWIGIFYPILRLIHPKFIG-PILQAPA-AVAPKEMI-------FYGFLKPW----LGD 134

  Fly   114 PMGALTLPLAKYHHWKESRQCMSQLFTSGRMRDVM--YSQMLDVASDLEQYLNRKLGDRLERVLP 176
              |.|   ::....|...|:.::..|....::..:  :::.:::.....|.|..|...||:    
  Rat   135 --GLL---VSAGEKWSRQRRLLTPAFHFDILKPYVKNFNKSVNIMHAKWQRLTAKGSARLD---- 190

  Fly   177 LGRMCQLYTTDVTGNLFYSLNVGGLRRGRSELITKTKELFNT------NPRKVLDFMSVFFLPKW 235
            :.....|.|.|......:|.: ...:...||.|...:||.:.      .|...:||:  ::|.. 
  Rat   191 MFEHISLMTLDSLQKCVFSFD-SNCQESPSEYIAAIQELSSLIVKRHHQPFLYMDFL--YYLTA- 251

  Fly   236 TGVLKPKV------FTEDYARYMRHL-----VDDH-HEPTKGDLINQLQHFQLSRSSNHYSQHPD 288
            .|....|.      ||:...|..|..     ||:. ...||...::.:....|::..:......:
  Rat   252 DGRRFRKACDLVHNFTDAVIRERRRTLSSQSVDEFLKSKTKSKTLDFIDVLLLAKDEHGKELSDE 316

  Fly   289 FVASQAGIILLAGFETSSALMGFTLYELAKAPDIQERLRSELREAF--ISTATLSYDTLMTLPYL 351
            .:.::|...:..|.:|:::.:.:.||.||:.|:.|||.|.|:||..  .....:.:|.|..||:|
  Rat   317 DIRAEADTFMFGGHDTTASALSWILYNLARHPEHQERCRQEVRELLRDREPEEIEWDDLTQLPFL 381

  Fly   352 KMVCLEALRLYPAAAFVNRECTSSA--SEGFSLQPHVDFIVPPGMPAYISILGLHRDERFWPEPC 414
            .|...|:|||:|....::|.||...  .:|        .::|.|....|||.|:|.:...||:|.
  Rat   382 TMCIKESLRLHPPVTVISRCCTQDVVLPDG--------RVIPKGNDCIISIFGVHHNPSVWPDPE 438

  Fly   415 VFDPERFGPERSRHIHPMTYIPFGAGPHGCIGSRLGVLQLKLGIVHILKQYWVETCERTVSEIRF 479
            |:||.||..|..:...|:.:|||.|||..|||....:.::|:.:...|.::.:...::   |.|.
  Rat   439 VYDPFRFDSENPQKRSPLAFIPFSAGPRNCIGQTFAMNEMKVAVALTLLRFRLLPDDK---EPRR 500

  Fly   480 NPKSFMLESENEIYLR 495
            .|: .:|.:|..::||
  Rat   501 KPE-LILRAEGGLWLR 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 120/489 (25%)
Cyp4f17NP_001178915.1 p450 52..514 CDD:278495 123/500 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.