DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t3 and Cyp313b1

DIOPT Version :9

Sequence 1:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001287239.1 Gene:Cyp313b1 / 41019 FlyBaseID:FBgn0037601 Length:502 Species:Drosophila melanogaster


Alignment Length:539 Identity:137/539 - (25%)
Similarity:219/539 - (40%) Gaps:130/539 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLIWLLLLTIVTLNFWLRHKYDY---FRSRGIPHLPPSSWSPMGNLGQLLFLRISFGDLFRQLY 62
            :||.||..|       |.|.:| |   ::.||     |..| |:..:|    |::...:.|.| |
  Fly    11 LLLAWLYFL-------WSRRRY-YKVAWQLRG-----PIGW-PLIGMG----LQMMNPETFLQ-Y 56

  Fly    63 ADPRNGQAKI-----VGFFIFQTPALMVRDPELIRQVLIKNFNNFLN-----RFESADAGDPMGA 117
            .|..:.|.|.     :|...|    |.:.||..:.|:|  |..:..|     ||.|:..||.:..
  Fly    57 MDGLSRQFKAPFISWMGTSCF----LYINDPHSVEQIL--NSTHCTNKGDFYRFMSSAIGDGLFT 115

  Fly   118 LTLPLAKYHHWKESRQCMSQLFTSGRMRDVMYSQMLDVASDLEQYLNRKL-------GDRLE--- 172
            .:.|     .|.:.|:.::..|  ||.   :.|..|.:.:...:.|.:||       |.|||   
  Fly   116 SSSP-----RWHKHRRLINPAF--GRQ---ILSNFLPIFNAEAEVLLQKLELEGVQHGKRLEIYQ 170

  Fly   173 --RVLPLGRMCQL-------YTTDVTGNLFYSLNVGGLRRGRSELITKTKELFNTNPRKVLDFMS 228
              :.:.|...||.       :..|.:..:|.:.|      |.:|:..|         |.:..::.
  Fly   171 ILKKIVLEAACQTTMGKKMNFQHDGSLCIFKAYN------GLTEVCVK---------RMLSPWLY 220

  Fly   229 VFFLPKWTGV--LKPKV------FTEDYARYMRHLVDDHHEP------------TKGDLINQLQH 273
            ...:.:.:|:  |:.||      |.|.....:..:|..:..|            :|...|.|::.
  Fly   221 PDLIYRRSGLFRLQQKVVGILFGFIEQLLEPIVSVVAANSNPDQQRSEMEMRGKSKAIFIEQVRE 285

  Fly   274 F----QLSRSSNHYSQHPDFVASQAGIILLAGFETSSALMGFTLYELAKAPDIQERLRSELREAF 334
            .    |||...         |..:|.:.:.|.|||:|..:.||:..||..|..||:|..||....
  Fly   286 HVERGQLSWQD---------VRDEANVTIAATFETTSTALYFTILCLAMHPCYQEKLHKELVTEL 341

  Fly   335 ISTATLSYDTLMTLPYLKMVCLEALRLYPAAAFVNRECTSSASEGFSL-QPHVDFIVPPGMPAYI 398
            ..:..::.:.|..|.|.:||..||:||:.....|.|    ||.:...| :...:|::|.|....|
  Fly   342 PPSGDINLEQLQRLEYTEMVINEAMRLFAPVPMVLR----SADQDIQLKRGDGEFLIPRGTQIGI 402

  Fly   399 SILGLHRDERFW-PEPCVFDPE-RFG---PERSRHIHPMTYIPFGAGPHGCIGSRLGVLQLKLGI 458
            .|..:.||||.| |....::|: .||   |:|    |...::||..|...|||.|...:.:||.:
  Fly   403 DIYNMQRDERVWGPLSRTYNPDAHFGLDSPQR----HAFAFVPFTKGLRMCIGYRYAQMLMKLLL 463

  Fly   459 VHILKQYWVETCERTVSEI 477
            ..|.:.|.:.| |..:.|:
  Fly   464 ARIFRSYRIST-EARLEEL 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 126/503 (25%)
Cyp313b1NP_001287239.1 p450 33..474 CDD:299894 125/499 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.