DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t3 and CYP4F3

DIOPT Version :9

Sequence 1:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_000887.2 Gene:CYP4F3 / 4051 HGNCID:2646 Length:520 Species:Homo sapiens


Alignment Length:580 Identity:138/580 - (23%)
Similarity:234/580 - (40%) Gaps:172/580 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WLLLLTIVTLNFWLRHK-----YDYF----RSRGIPHLPPSSWSPMGNLG-------QLLF---L 50
            |||||.:..  .||..:     |.::    |.|..|..|..:|. :|:||       .||:   |
Human    19 WLLLLLVGA--SWLLARILAWTYTFYDNCCRLRCFPQPPKRNWF-LGHLGLIHSSEEGLLYTQSL 80

  Fly    51 RISFGD--------------LFRQLYADPRNGQAKIVGFFIFQTPALMVRDPELIRQVLIKNFNN 101
            ..:|||              :|...|..|          .:|...|::.:|         |.|.:
Human    81 ACTFGDMCCWWVGPWHAIVRIFHPTYIKP----------VLFAPAAIVPKD---------KVFYS 126

  Fly   102 FLNRFESADAGDPMGALTLPLAKYHHWKESRQCMSQLFTSGRMR----------DVMYSQMLDVA 156
            ||..:    .||  |.|   |:....|...|:.::..|....::          ::|:::...:|
Human   127 FLKPW----LGD--GLL---LSAGEKWSRHRRMLTPAFHFNILKPYMKIFNESVNIMHAKWQLLA 182

  Fly   157 S------DLEQYLNRKLGDRLER-VLPLGRMCQLYTTDVTGNLFYSLNVGGLRRGRSELITKTKE 214
            |      |:.::::....|.|:: |......||...::....:.          ..|.|:||..:
Human   183 SEGSARLDMFEHISLMTLDSLQKCVFSFDSHCQEKPSEYIAAIL----------ELSALVTKRHQ 237

  Fly   215 ---LFNTNPRKVLDFMSVFFLPKWTGVLKPKVFTEDYARYMR--HLVDDHHE----------PTK 264
               |:       :||:  ::|            |.|..|:.|  .||.|..:          |::
Human   238 QILLY-------IDFL--YYL------------TPDGQRFRRACRLVHDFTDAVIQERRRTLPSQ 281

  Fly   265 G--------------DLINQLQHFQLSRSSNHYSQHPDFVASQAGIILLAGFETSSALMGFTLYE 315
            |              |.|:.|   .||:..:......:.:.::|...:..|.:|:::.:.:.||.
Human   282 GVDDFLQAKAKSKTLDFIDVL---LLSKDEDGKKLSDEDIRAEADTFMFEGHDTTASGLSWVLYH 343

  Fly   316 LAKAPDIQERLRSELREAF--ISTATLSYDTLMTLPYLKMVCLEALRLYPAAAFVNRECTSS--A 376
            |||.|:.|||.|.|::|..  .....:.:|.|..||:|.|...|:|||:|....|:|.||..  .
Human   344 LAKHPEYQERCRQEVQELLKDREPKEIEWDDLAQLPFLTMCIKESLRLHPPVPAVSRCCTQDIVL 408

  Fly   377 SEGFSLQPHVDFIVPPGMPAYISILGLHRDERFWPEPCVFDPERFGPERSRHIHPMTYIPFGAGP 441
            .:|        .::|.|:...||:.|.|.:...||:|.|:||.||.|:..:...|:.:|||.|||
Human   409 PDG--------RVIPKGIICLISVFGTHHNPAVWPDPEVYDPFRFDPKNIKERSPLAFIPFSAGP 465

  Fly   442 HGCIGSRLGVLQLK--LGIV----HILKQYWVETCERTVSEIRFNPKSFMLESENEIYLR 495
            ..|||....:.::|  ||:.    .:|..:         :|.|..|: .:|.:|..::||
Human   466 RNCIGQAFAMAEMKVVLGLTLLRFRVLPDH---------TEPRRKPE-LVLRAEGGLWLR 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 123/531 (23%)
CYP4F3NP_000887.2 p450 52..515 CDD:365848 126/543 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.