DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t3 and Cyp316a1

DIOPT Version :9

Sequence 1:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_648129.2 Gene:Cyp316a1 / 38840 FlyBaseID:FBgn0035790 Length:484 Species:Drosophila melanogaster


Alignment Length:521 Identity:113/521 - (21%)
Similarity:191/521 - (36%) Gaps:125/521 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLTIVTLNFWLRHKYDYFRSRG----IPHLP-PSSWSPMGNLGQLLFLR------------ISF 54
            ::||...:.|.|...::|||:|.    |.:|. |.:|..||.:.:||||.            ..:
  Fly     1 MILTATFICFCLASAFNYFRARRQRSLIKNLKGPFTWPLMGAMHKLLFLTPINFFQRSTEYLTKY 65

  Fly    55 GDLFRQLYADPRNGQAKIVGFFIFQTPALMVRDPELIRQVLIKNFNNFLNRFESADAGDPMGALT 119
            |...|               .::|....:.:.|.||.|| |::|..:....:|........|.| 
  Fly    66 GTFSR---------------CWVFHRLFIPLADLELSRQ-LLENDTHLETGYELMKDWLVGGVL- 113

  Fly   120 LPLAKYHHWKESRQCMSQLFTSGRMRDVMYSQMLDVASDLEQYLNRKLGDRLER--------VLP 176
              :.:...|::....:|.||..|.:     .|::|::....:.|.:||..:.::        |.|
  Fly   114 --MCQSEQWQKRHSLISGLFDKGNL-----EQLIDLSRHQTEQLLQKLAKQADQKVFDIWYTVSP 171

  Fly   177 LGRMCQLYTT-DVTGNLFYSLNVGGLRRGRSELITKTKELFNTNPRKVLDFMSVFFLPKWTGVLK 240
            :.....:.|| ....:..||.|:..|    ||:..|.             |:|:....::...|.
  Fly   172 IVLDLMVMTTCGAKPSEEYSKNLKDL----SEIYRKR-------------FLSLQSANRFNYWLS 219

  Fly   241 PKVFTEDYARYMRHLVDDH------HEPTKGDLINQLQHFQLSRSSNHYSQHP------------ 287
            .....:...|.::.|.|:|      |:..     |||   ::....:.|...|            
  Fly   220 SPFMRKRQNRLIKRLNDEHNNLMAMHQSQ-----NQL---KIENGLDIYQLRPIPLKDHKSLLEI 276

  Fly   288 -----------DFVASQAGIILLAGFETSSALMGFTLYELAKAPDIQERLRSELREAFISTATLS 341
                       :.:..:.......|::..|..:.|.|..:|:.|.:|::...||..|.|...  .
  Fly   277 LLESKDPQLTGEEICGELNTCNYLGYQLCSPALCFCLVTIARNPSVQQKCLDELNLAQIKDQ--G 339

  Fly   342 YDTLMTLPYLKMVCLEALRLYPAAAFVNRECTSSASEGFSLQPHVDFIV-----PPGMPAYISIL 401
            :| |..|.||..|..|.:||||....|.|:.....       |:...||     |.|...||::.
  Fly   340 WD-LEKLNYLDAVLHETMRLYPPQVIVGRQLKKDF-------PYTHSIVGDAELPCGSEIYINLY 396

  Fly   402 GLHRDERFWPEPCVFDPERFGPERSRHIHPMTYIPFGAGPHGCIGSRLGVLQLKLGIVHILKQYW 466
            .|.|:|..:|:...||.:||...      |...:.:..||..|...:..:..||..:..||..:.
  Fly   397 ELQRNEVRYPKANHFDAQRFLDS------PPELLSYSLGPRCCPARKFSMQLLKTLLAPILANFE 455

  Fly   467 V 467
            |
  Fly   456 V 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 103/490 (21%)
Cyp316a1NP_648129.2 p450 33..466 CDD:299894 103/489 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.