DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t3 and Cyp4p3

DIOPT Version :9

Sequence 1:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_610473.1 Gene:Cyp4p3 / 35948 FlyBaseID:FBgn0033397 Length:515 Species:Drosophila melanogaster


Alignment Length:575 Identity:137/575 - (23%)
Similarity:230/575 - (40%) Gaps:139/575 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLIWLLLLTIVTLNFWLRHKYDYF-------RSRGIPHLPPSSWSPMGNLGQLLFLRISFGDLF 58
            ||::||:...||.:.:..|...||.       |.|......|.|.:|:.. |..:|.. ||    
  Fly     1 MLILWLVGAFIVLIQWIYRLNRDYCILGFFAKRIRTKNGQNPESIAPLVK-GSTIFAN-SF---- 59

  Fly    59 RQLYADPRNGQ-------AKIVG----FFIFQTPALMVRDPELIRQVLIKNFNNFLNRFESADAG 112
             .||....:|.       ||.:|    .:...|....|.|.:...:||  |..|.:|:....|..
  Fly    60 -DLYGKDHSGVFEHSRDCAKKLGKSYAEYAMGTAIYNVIDADSAERVL--NDPNLINKGTIYDFL 121

  Fly   113 DPM---GALTLPLAKYHHWKESRQCMSQLF---TSGRMRDVMYSQMLDVASDLEQYLNRKLGDR- 170
            .|.   |.||....|   |...|:.:|..|   ...:.:::..::.|..   |||:   |..|. 
  Fly   122 HPFLRTGLLTSTGKK---WHARRKMLSPTFHFNILNQFQEIFITESLKF---LEQF---KGNDEA 177

  Fly   171 ---LERVLP---LGRMCQLYTTDVTGNLFYSLNVGGLRRGRSELITKTKELFNTNPRKVLDFMSV 229
               |..|:|   |..:|:                       :.:..|..|:.....|...:|..:
  Fly   178 IISLNEVIPRFTLNSICE-----------------------TAMGVKLDEMAEKGDRYRENFRQI 219

  Fly   230 --FFLPK------WTGVLKPKVFTE-DYARYM--------------RHLVDDHHEPTKGDLINQL 271
              .|:.:      |:..|. |:|.| |||..:              |..::|..: ::|:  .|.
  Fly   220 EECFIRRMSNPLLWSDTLF-KMFAEKDYASALDVVHGFSSEIIAKRRDQLNDEID-SRGN--TQT 280

  Fly   272 QHFQLSRSSNHYSQ-------HPDFVASQAGI------ILLAGFETSSALMGFTLYELAKAPDIQ 323
            ...:|..|...::.       ..|.:....||      ::..|::|:|..:.|.|..::..|:.|
  Fly   281 AEDELFTSKKRFAMLDTLILAEKDGLIDHIGICEEVDTLMFEGYDTTSIGLMFGLMNMSLYPEEQ 345

  Fly   324 ERLRSELREAFISTA--TLSYDTLMTLPYLKMVCLEALRLYPAAAFVNRECT--SSASEGFSLQP 384
            |:...|: :|.|...  .|:...|..|..|:....|.:||:|:...:.||.|  :..|.|     
  Fly   346 EKCYQEI-QANIDDELNILNIGQLNKLKNLEYFIKETMRLFPSVPAMGRETTRETELSNG----- 404

  Fly   385 HVDFIVPPGMPAYISILGLHRDERFWPEPCVFDPERFGPERSRHIHPMTYIPFGAGPHGCIGSRL 449
               .|:|.|...::.:..:||:..:|..|..|.||||.||.|::.|...||||.||...|||.:.
  Fly   405 ---LILPKGSQIFVHVFDIHRNPEYWDSPEEFRPERFLPENSQNRHTYAYIPFSAGQRNCIGQKF 466

  Fly   450 GVLQLKLGIVHILKQYWVETCERTVSEIRFNPKSFM------LESENEIYLRFCR 498
            .:.::|..:|.:|||:.:      :.||  :||:.:      |.::|:|:::..|
  Fly   467 AMQEMKTLMVALLKQFQI------LPEI--DPKTIVFQTGLTLRTKNQIHVKLVR 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 122/521 (23%)
Cyp4p3NP_610473.1 p450 54..505 CDD:278495 119/511 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.