DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t3 and Cyp4p2

DIOPT Version :9

Sequence 1:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_610472.1 Gene:Cyp4p2 / 35946 FlyBaseID:FBgn0033395 Length:520 Species:Drosophila melanogaster


Alignment Length:585 Identity:122/585 - (20%)
Similarity:208/585 - (35%) Gaps:162/585 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LIWLLLLTIVTLNFWLRHKYDY----FRSRGIPHLPPSSWSPMGNLGQLLFLRISFGDLFRQLYA 63
            |:|:.:..:|.:::..:...||    |.:|   .:......|:.:|..::..|..|.:.|..|..
  Fly     5 LLWISVAILVVIHWIYKVNKDYNILAFFAR---RVQTKDGKPLDSLVPMIKGRTVFANCFDLLGK 66

  Fly    64 D------------PRNGQAKI---VGFFIF-----QTPALMVRDPELIRQVLIKNF-NNFLNRFE 107
            |            ..:|.:.:   :||..|     ...|.::..|.||.:.:|.|| :.||.   
  Fly    67 DTDQVFTHLRQLAKNSGDSYLQYSMGFSNFNVIDAHNAANILNHPNLITKGVIYNFLHPFLR--- 128

  Fly   108 SADAGDPMGALTLPLAKYHHWKESRQCMSQLF---TSGRMRDVMYSQMLDVASDLEQYLNR---K 166
                   .|.||   |....|...|..:::.|   ...:.:::..::.|...|.. |..|.   .
  Fly   129 -------TGVLT---ATEKKWHTRRSMLTRTFHLDILNQFQEIFIAESLKFVSQF-QGQNEVVVS 182

  Fly   167 LGDRLERVLPLGRMCQ-----------------------------------LYTTDVTGNLF--- 193
            |.||:.| ..|..:|:                                   ||..|...|:|   
  Fly   183 LKDRISR-FTLNSICETAMGIKLDEMAEKGDRYRANFHIIDEGLTRRIVNPLYWDDCVYNMFTGH 246

  Fly   194 -YSLNVGGLRRGRSELITKTK-----ELFNTNPRKVLDFMSVFFLPKWTGVLKPKVFTEDYARYM 252
             |:..:..:.....|:|.|.:     ||.|....:..|........|...:|...:..|      
  Fly   247 KYNAALKVVHEFSREIIAKRRVLLEEELENRRATQTADDDICVIRKKRFAMLDTLICAE------ 305

  Fly   253 RHLVDDHHEPTKGDLINQLQHFQLSRSSNHYSQHPDFVASQAGIILLAGFETSS-----ALMGFT 312
                       |..||:.:.                 ::.:...::..|::|:|     .||..:
  Fly   306 -----------KDGLIDDIG-----------------ISEEVDTLMAEGYDTTSIGLVFGLMNMS 342

  Fly   313 LYELAKA---PDIQERLRSELREAFISTATLSYDTLMTLPYLKMVCLEALRLYPAAAFVNRECTS 374
            ||...:.   .:|||.:..:|       :.|:...|..|.||.....|.:||||:...:.|:...
  Fly   343 LYAAEQELCYQEIQEHILDDL-------SNLNLSQLSKLNYLGYFIKETMRLYPSIPIMGRQTLQ 400

  Fly   375 SASEGFSLQPHVDFIVPPGMPAYISILGLHRDERFWPEPCVFDPERFGPERSRHIHPMTYIPFGA 439
            .......|      |:|......|.:..:||:.::|..|..|.||||.|:.....||..||||.|
  Fly   401 ETELENGL------ILPKRSQINIHVFDIHRNPKYWESPEEFRPERFLPQNCLKRHPYAYIPFSA 459

  Fly   440 GPHGCIGSRLGVLQLKLGIVHILKQYWVETCERTVSEIRFNPKSFM------LESENEIYLRFCR 498
            |...|||.:..:.::|..:|.|||.:.:...        .:|||.:      |..:|:|.::..|
  Fly   460 GQRNCIGQKYAMQEMKTLMVVILKHFKILPV--------IDPKSIVFQVGITLRFKNKIKVKLVR 516

  Fly   499  498
              Fly   517  516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 111/536 (21%)
Cyp4p2NP_610472.1 p450 63..514 CDD:299894 109/520 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.