DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t3 and Cyp6a14

DIOPT Version :9

Sequence 1:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001286199.1 Gene:Cyp6a14 / 35835 FlyBaseID:FBgn0033302 Length:509 Species:Drosophila melanogaster


Alignment Length:545 Identity:164/545 - (30%)
Similarity:262/545 - (48%) Gaps:90/545 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLIWLLLLTIVTLNFWLRHK-YDYFRSRGIPHLPPSSWSP-MGNLGQLLFLRISFGDLFRQLYA 63
            ||....|:..::.|.:.|..| :.|::.:|:||..|   .| :||:..:: .:..|.|:.:::|.
  Fly     1 MLFTIALVGVVLGLAYSLHIKIFSYWKRKGVPHETP---LPIVGNMRGIV-KKYHFRDINQRIYK 61

  Fly    64 DPRNGQAKIVGFFIFQTPALMVRDPELIRQVLIKNFNNFLNRFESADAGDPMGALTLP------- 121
            ..: ||..|.|.::|.....::.|.:.|:||:||:|:.|.:|          ||.|.|       
  Fly    62 KFK-GQGPIAGMYMFFKRTALITDLDFIKQVMIKDFSYFQDR----------GAFTNPRDDPLTG 115

  Fly   122 ---LAKYHHWKESRQCMSQLFTSGRMRDVMYSQMLDVASDLEQYLNRKLGDRLERVLPLGR---- 179
               ..:...|:..|..::.:||||:::     ||..|..|    :..:|||.:::.:...:    
  Fly   116 HLFALEGEEWRAMRHKLTPVFTSGKIK-----QMSKVIVD----VGLRLGDAMDKAVKEAKVEEG 171

  Fly   180 ------MCQLYTTDVTGNLFYSLNVGGLRRGRSELITKTKELFN-------------TNPR---- 221
                  :|..:||||.|:..:.|....|:...:|...|.:|:|.             ||.|    
  Fly   172 NVEIKDLCARFTTDVIGSCAFGLECNSLQDPSAEFRQKGREIFTRRRHSTLVQSFIFTNARLARK 236

  Fly   222 ---KVL-DFMSVFFLPKWTGV----LKPKVFTEDYARYMRHL-VDDHHEPTKGDLINQLQHFQLS 277
               ||| |.::.||:......    ||..:...|:...|..| .:|.....||..|:......|.
  Fly   237 LRIKVLPDDLTQFFMSTVKNTVDYRLKNGIKRNDFIEQMIELRAEDQEAAKKGQGIDLSHGLTLE 301

  Fly   278 RSSNHYSQHPDFVASQAGIILLAGFETSSALMGFTLYELAKAPDIQERLRSELRE--AFISTATL 340
            :           :|:||.:..:|||||||:.|...|||||..||||:|||.|:..  |.:....|
  Fly   302 Q-----------MAAQAFVFFVAGFETSSSTMSLCLYELALQPDIQQRLREEIESVLANVDGGEL 355

  Fly   341 SYDTLMTLPYLKMVCLEALRLYPAAAFVNRECTSSASEGFSLQPHVDFIVPPGMPAYISILGLHR 405
            :||.|..:.||..|..|.||.:|....:.||.|    :.:.: |:.|.::..|:.|.|.:..:|.
  Fly   356 NYDVLAQMTYLDQVLSETLRKHPLLPHLIRETT----KDYQI-PNSDIVLDKGILALIPVHNIHH 415

  Fly   406 DERFWPEPCVFDPERFGPERSRHIHPMTYIPFGAGPHGCIGSRLGVLQLKLGIVHILKQYWVETC 470
            |...:|||..|||.||.||..::.|||.|:|||.||..|||.|.|.:|.|:|:|.:|:::.....
  Fly   416 DPEIYPEPEKFDPSRFDPEEVKNRHPMAYLPFGDGPRNCIGLRFGKIQAKIGLVSLLRRFKFSVS 480

  Fly   471 ERTVSEIRFNPKSFMLESENEIYLR 495
            .||...:.|:.|||:|.:.:.|||:
  Fly   481 NRTDVPLIFSKKSFLLTTNDGIYLK 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 150/500 (30%)
Cyp6a14NP_001286199.1 p450 32..506 CDD:306555 156/514 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 151 1.000 Domainoid score I1386
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I1621
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 1 1.000 - - otm3438
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X40
88.070

Return to query results.
Submit another query.