DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t3 and Cyp4e2

DIOPT Version :9

Sequence 1:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001286196.1 Gene:Cyp4e2 / 35822 FlyBaseID:FBgn0014469 Length:526 Species:Drosophila melanogaster


Alignment Length:443 Identity:95/443 - (21%)
Similarity:175/443 - (39%) Gaps:97/443 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 MGALTLPLAKYHHWKESRQCMSQLFTSGRMRDVMYSQMLDVASDLEQYLNR-KLGDRLERVLPLG 178
            :|.||...:|   |.:.|:.::..|....::| .:..|.:.::...::|.. ..||   .:....
  Fly   114 LGLLTSTGSK---WHKHRKMITPAFHFNILQD-FHEVMNENSTKFIKHLKTVAAGD---NIFDFQ 171

  Fly   179 RMCQLYTTDVTGNLFYSLNVGGLRRGRSELITKTKEL-FNTNPRKVLDFMSVFFLPKWTGVLKPK 242
            ......|.||..:....:::..:....|.::...|:: :|.|.|.        |.|.....|..:
  Fly   172 EQAHYLTLDVICDTAMGVSINAMENRSSSIVQAFKDMCYNINMRA--------FHPLKRNELLYR 228

  Fly   243 VFTEDYARYMRHLVDDHHEPTKGDLINQL------QHFQLSRSSNHYSQHP-------DFVAS-- 292
            : ..||..|.|.|      .|..|..|::      .|...:.|:|...:..       |.:.|  
  Fly   229 L-APDYPAYSRTL------KTLQDFTNEIIAKRIEAHKSGAVSTNAGDEFTRKKMAFLDTLLSST 286

  Fly   293 -------------QAGIILLAGFETSSALMGFTLYELAKAPDIQERLRSELREAFISTATLSYDT 344
                         :....:..|.:|:::.:.|.:|.|::..|.|.:|..|.||. :..:.|..|.
  Fly   287 IDGRPLNSKELYEEVSTFMFEGHDTTTSGVSFAVYLLSRHQDEQRKLFKEQREV-MGNSELGRDA 350

  Fly   345 ----LMTLPYLKMVCLEALRLYPAAAFVNRECTSSASEGFSLQPHV--DFIVPPGMPAYISILGL 403
                :..:.||.:...||.|:||:..|:.|         |:.:.:|  ..:||.|....:.::.|
  Fly   351 TFQEISQMKYLDLFIKEAQRVYPSVPFIGR---------FTEKDYVIDGDLVPKGTTLNLGLVML 406

  Fly   404 HRDERFWPEPCVFDPERFGPERSRHIHPMTYIPFGAGPHGCIGSRLGVLQLKLGIVHILKQYWV- 467
            ..:|:.:.:|..|.||||..|:.   .|..|:||.|||..|||.:..:|::|..:..|::.:.| 
  Fly   407 GYNEKVFKDPHKFRPERFELEKP---GPFEYVPFSAGPRNCIGQKFALLEIKTVVSKIIRNFEVL 468

  Fly   468 ----------------------ETCERTVSEIRFNP---KSFMLESENEIYLR 495
                                  |..:|.....:::|   ....|:|||.:|:|
  Fly   469 PALDELVSKDGYISTTIGLPDAERKKRDPYRHKYDPILSAVLTLKSENGLYIR 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 89/432 (21%)
Cyp4e2NP_001286196.1 p450 35..469 CDD:278495 86/389 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.