DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t3 and Cyp9b2

DIOPT Version :9

Sequence 1:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_523646.1 Gene:Cyp9b2 / 35635 FlyBaseID:FBgn0015039 Length:505 Species:Drosophila melanogaster


Alignment Length:509 Identity:151/509 - (29%)
Similarity:243/509 - (47%) Gaps:51/509 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLTIVTLNF----WLRHKYDYFRSRGIPHLPPSSWSPMGNLGQLLFLRISFGDLFRQLYADPRN 67
            :.|.:|.:.:    |....:..|..|.:....|..:  :||:......:.||.....:.|  .|.
  Fly     6 ICLALVVIGYLIYKWSTATFKTFEERKLYFEKPYPF--VGNMAAAALQKSSFQRQLTEFY--ERT 66

  Fly    68 GQAKIVGFFIFQTPALMVRDPELIRQVLIKNFNNFLNRFESADAGDPMGALTLPLAKYHHWKESR 132
            .|.|:||||..:||.:.:.|||||::|.:|:|::|.|......:.|.:....|.:.:...||..|
  Fly    67 RQHKLVGFFNMRTPMITLNDPELIKKVCVKDFDHFPNHQPFITSNDRLFNDMLSVMRDQRWKHMR 131

  Fly   133 QCMSQLFTSGRMRDVMYSQMLDVASDLEQYLNRKLGDRLERVLPLGR---------MCQLYTTDV 188
            ..::.:||:.:||: |::.|.:..::..|:|     |...:.|| ||         ||...:.|:
  Fly   132 NTLTPVFTAAKMRN-MFTLMNESFAECLQHL-----DSSSKTLP-GRKGFEVDMKVMCNKLSNDI 189

  Fly   189 TGNLFYSLNVGGLRRGRSELITKTKELFNTNPRKVLDFMSVFFLPKWTGVLKPKVFTEDYARYMR 253
            .....:.|.|......::|.....:.|..:...:...||....:||...:||..:|......|..
  Fly   190 IATTAFGLKVNSYDNPKNEFYEIGQSLVFSRGLQFFKFMLSTLVPKLFSLLKLTIFDSAKVDYFA 254

  Fly   254 HLV------DDHHEPTKGDLINQLQHFQLSRSSNHYSQHPDFVASQAGIILLAGFETSSALMGFT 312
            .||      .:.|..|:.|:|..|...: :.|.:.::.  |.:.:|..|...|.||.:|.|:..|
  Fly   255 RLVVEAMQYREKHNITRPDMIQLLMEAK-NESEDKWTD--DEIVAQCFIFFFAAFENNSNLICTT 316

  Fly   313 LYELAKAPDIQERLRSELREA--FISTATLSYDTLMTLPYLKMVCLEALRLYPAAAFVNREC--- 372
            .|||...||:||||..|:.|.  .::.|.|:||.:..:.|:.||..|:||.:..||..:|.|   
  Fly   317 TYELLYNPDVQERLYEEIVETKKALNGAPLTYDAVQKMTYMDMVISESLRKWTLAAATDRLCSKD 381

  Fly   373 -TSSASEGFSLQPHVDFIVPPGMPAYISILGLHRDERFWPEPCVFDPERFGPERSRHIHPMTYIP 436
             |.:..:|..|   .||.|  |....|.|.|||.|:|::|||..|||:||..||...:.|.||:|
  Fly   382 YTLTDDDGTKL---FDFKV--GDRINIPISGLHLDDRYFPEPRKFDPDRFSEERKGDMVPYTYLP 441

  Fly   437 FGAGPHGCIGSRLGVLQLKLGIVHILKQYWVETCERTVSEI-------RFNPKS 483
            ||.||..|||:|..::|:|..:.::|..|.:|...||:.::       .|.|:|
  Fly   442 FGVGPRNCIGNRYALMQVKGMLFNLLLHYKIEASPRTIKDLWGSASGFNFTPRS 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 146/478 (31%)
Cyp9b2NP_523646.1 p450 37..478 CDD:299894 141/459 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461037
Domainoid 1 1.000 151 1.000 Domainoid score I1386
eggNOG 1 0.900 - - E2759_KOG0158
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I1621
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 1 1.000 - - otm3438
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X40
109.900

Return to query results.
Submit another query.