DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t3 and Cyp4ac2

DIOPT Version :9

Sequence 1:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_608917.3 Gene:Cyp4ac2 / 33755 FlyBaseID:FBgn0031694 Length:511 Species:Drosophila melanogaster


Alignment Length:517 Identity:101/517 - (19%)
Similarity:188/517 - (36%) Gaps:127/517 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 GQLLFLRI-------SFGDLF-------RQLYADPRNGQAKIVG----FFIFQTPALMVRDPELI 91
            |.||..:|       .||:.|       ..::...|:..||..|    ::.|..|...:...|..
  Fly    41 GSLLESKIYVAPSKTRFGNNFDLVNFTSESIFNFMRDASAKAKGRNYLWYFFHAPMYNIVRAEEA 105

  Fly    92 RQVLIKNFNNFLNRFESADAGDPMGALTLPLAKYHHWKESRQCMSQLFTSGRMRD---VMYSQML 153
            .::|  ..:..:.:....:...|.....|.::....|...|:.::..|....::.   :...:..
  Fly   106 EEIL--QSSKLITKNMIYELLKPFLGEGLLISTDQKWHSRRKALTPAFHFKVLQSFLIIFKEECN 168

  Fly   154 DVASDLEQYLNRKLGDRLERVLP---LGRMCQL--------------YTTDVTG----------- 190
            .:...|.|.:|.:|  .|.:|:|   |..:|:.              |...:..           
  Fly   169 KLVKVLHQSVNMEL--ELNQVIPQFTLNNVCETALGVKLDDLSEGIRYRQSIHAIEEVMQQRLCN 231

  Fly   191 ----NLFYSLNVGGLRRG----------RSELITKTKELFNTNPRKVLDFMSVFFLPKWTGVLKP 241
                |:.|....|..|:.          .|.:|.|.:.||.:|                      
  Fly   232 PFFYNIVYFFLFGDYRKQVNNLKIAHEFSSNIIEKRRSLFKSN---------------------- 274

  Fly   242 KVFTED-YARYMRHLVDDHHEPTKGDLINQLQHFQLSRSSNHYSQHPDFVASQAGIILLAGFETS 305
            ::..|| :.:..|:.:.|.....:.|  .|:.|              ..:..:....:..|::|:
  Fly   275 QLGQEDEFGKKQRYAMLDTLLAAEAD--GQIDH--------------QGICDEVNTFMFEGYDTT 323

  Fly   306 SALMGFTLYELAKAPDIQERLRSELREAFISTATLSYDTLMTLPYLKMVCLEALRLYPAAAFVNR 370
            |..:.|||..||...|:|::...|::.....:..:|......|.|::.|..|:|||:|:..|:.|
  Fly   324 STCLIFTLLMLALHEDVQKKCYEEIKYLPDDSDDISVFQFNELVYMECVIKESLRLFPSVPFIGR 388

  Fly   371 ECTSSASEGFSLQPHVDFIVPPGMPAYISILGLHRDERFWPEPCVFDPERFGPERSRHIHPMTYI 435
            .|.......       ..|:|......|.:..:.||.|.:..|.:|.|:||.||.:.:.||..::
  Fly   389 RCVEEGVVN-------GLIMPKNTQINIHLYEIMRDARHFSNPKMFQPDRFFPENTVNRHPFAFV 446

  Fly   436 PFGAGPHGCIGSRLGVLQLKLGIVHILKQYWVETCERTVSEIRFNPKSFM--LESENEIYLR 495
            ||.||...|||.:..:|::|:.:..:::.:            :..|.:.:  |..||.|.||
  Fly   447 PFSAGQRNCIGQKFAILEIKVLLAAVIRNF------------KILPVTLLDDLTFENGIVLR 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 95/506 (19%)
Cyp4ac2NP_608917.3 p450 57..505 CDD:278495 97/501 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.