DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t3 and Cyp309a1

DIOPT Version :9

Sequence 1:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001259943.1 Gene:Cyp309a1 / 33438 FlyBaseID:FBgn0031432 Length:506 Species:Drosophila melanogaster


Alignment Length:519 Identity:136/519 - (26%)
Similarity:215/519 - (41%) Gaps:98/519 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLTIV-----TLNFWLRHKYDYFRSRGIPHLPPSSWSPMGNLGQLLF-----LRISFGDLFRQL 61
            |.||||     .:.|:|...:.|:..||:....|  .:.:|:...:|.     |.:...|::.: 
  Fly     7 LCLTIVHVAFAVVYFYLTWYHKYWDKRGVVTAEP--LTILGSYPGILINKSRSLILDVQDVYNK- 68

  Fly    62 YADPRNGQAKIVGFFIFQTPALMVRDPELIRQVLIKNFNNFLNRFESADAGDPMGALTLPLAKYH 126
            |.|    :.:.||.||.:.|.|:|.||.|..::|:..|::|.:...|:..|             |
  Fly    69 YKD----KYRTVGTFITRQPQLLVLDPALAHEILVDKFSHFRDTITSSFVG-------------H 116

  Fly   127 HWKESRQCMSQLFTSG----RMRDV----MYSQMLDVASDLEQYLNRKLGDRLER-------VLP 176
            :..:.....|..|::|    |:|..    :....|.:|..:.:...|||.:.:||       ::.
  Fly   117 NPDDKYVAGSPFFSAGDKWKRLRSENVGGLTPSRLKMAYSIWEQSGRKLVEYIERARREQGDIIE 181

  Fly   177 LGRMCQLYTTDVTGNLFYSLNVGGLRRGRSEL--ITKT---------KELFNTNPRKVLDFMSVF 230
            ...:...:|.:...:..:.::.|.|.....|:  ..||         ..:...|...|..|:...
  Fly   182 TRDLAYRFTANAMADFIWGIDAGSLSGKVGEIGDFQKTSTDWSAHAFSSMIRFNKTLVAIFVRKL 246

  Fly   231 FLPKWTGVLKPKVFTEDYARYMRHLVDDHHEPTKG-------DLINQLQHFQLSRSSNHYSQHPD 288
            |        ..:.||:....:...|..|.....:|       |.::.|...|...:|.|.|    
  Fly   247 F--------SMRFFTKATDEFFLRLTQDAVNLRQGGSGEGRTDYLSHLIQLQQRGNSIHDS---- 299

  Fly   289 FVASQAGIILLAGFETSSALMGFTLYELAKAPDIQERLRSELREAFISTATLSYDTLMTLPYLKM 353
              ...|..:.|.|||||.|::...||.|::..:.||:||||:.||..|...:|||.:..||||..
  Fly   300 --VGHALTVHLDGFETSGAVLYHMLYSLSEHHEEQEKLRSEILEALASEGQISYDQINNLPYLDQ 362

  Fly   354 VCLEALRLYPAAAFVNRECTSSA------SEGFSLQPHVDFIVPPGMPAYISILGLHRDERFWPE 412
            ...|:|||.....|..|.||...      .:...|:|.|..:|    |||    ..|.|...:||
  Fly   363 CFNESLRLTTPIGFFMRICTKPTQINLGDDKTLDLEPGVTVMV----PAY----QYHHDNDIYPE 419

  Fly   413 PCVFDPERFGPERSRHIHPMT----YIPFGAGPHGCIGSRLGVLQLKLGIVHILKQYWVETCER 472
            ...|.|:||   .:.....:|    ::|||.||..|:|.|:|.|.:|..|||||..|.||..::
  Fly   420 ASEFRPDRF---ENGAASVLTKRGCFLPFGDGPRICLGMRVGQLSVKTAIVHILSNYQVEQMKK 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 126/487 (26%)
Cyp309a1NP_001259943.1 p450 49..481 CDD:299894 124/475 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460838
Domainoid 1 1.000 88 1.000 Domainoid score I2119
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 88 1.000 Inparanoid score I1773
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
66.000

Return to query results.
Submit another query.