DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t3 and Cyp4s3

DIOPT Version :9

Sequence 1:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_573003.2 Gene:Cyp4s3 / 32444 FlyBaseID:FBgn0030615 Length:495 Species:Drosophila melanogaster


Alignment Length:498 Identity:115/498 - (23%)
Similarity:196/498 - (39%) Gaps:91/498 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 PMGNLGQLLFLRISFGDLFRQLYADPRNGQAKIVGFFIFQTPALMVRDPELIRQVLIKNFNNFLN 104
            |...:|:|: ..:..|::...| .:.|.....:...:..:...:|..|||.|:|:|  ..|..|.
  Fly    36 PGPTIGELI-ANVKKGEILNWL-KELREKHGPVFRIWFGKDLMVMFTDPEDIKQLL--GNNQLLT 96

  Fly   105 RFESADAGDP---MGALTLPLAKYHHWKESRQCMSQLFTSG---RMRDVMYSQMLDVASDLEQYL 163
            :..:.:..:|   .|.||.....:|..:       :|.|.|   |:.......|.:....|.:.|
  Fly    97 KSRNYELLEPWLGKGLLTNGGESWHRRR-------KLLTPGFHFRILSEFKEPMEENCRILVRRL 154

  Fly   164 NRKLGDRLERVLPLGRMCQLYTTDVTGNLFYSLNVGGLRRGRSELITKTKELFNTNPRKVLDF-- 226
            ..|.......:.|   ...|:..|........:......:..||.:...:.:.....::...|  
  Fly   155 RTKANGESFDIYP---YITLFALDAICETAMGIKKHAQLQSDSEYVQAVQSICRVMHKQSFSFWQ 216

  Fly   227 -MSVFFLPKWTGVLKP--------KVFTEDYARYMR----HLVDDHH----EPTKGD-------- 266
             ::|||  |.|   ||        ||..::..|.:|    .|:.:.:    |..:.|        
  Fly   217 RLNVFF--KHT---KPGKEREAALKVLHDETNRVIRLRREQLIQERNEWKPEAEQDDVGAKRRLA 276

  Fly   267 -----LINQLQ-HFQLSRSSNHYSQHPDFVASQAGIILLAGFETSSALMGFTLYELAKAPDIQER 325
                 |:.|:: ..:||.:.         :..:....:..|.:|:|:.:.|.|..|:|.||:|:|
  Fly   277 FLDMLLLTQMEGGAELSDTD---------IREEVDTFMFEGHDTTSSAIAFALSLLSKNPDVQQR 332

  Fly   326 LRSELREAFISTATLSYDTLMTLPYLKMVCLEALRLYPAAAFVNRECTSSASEGFSLQPHVDFIV 390
                   ||...:.|......::|||:.|..|.||:||:..|.:|:.......|       ...|
  Fly   333 -------AFEEASELEGREKESMPYLEAVIKETLRIYPSVPFFSRKVLEDLEVG-------KLTV 383

  Fly   391 PPGMPAYISILGLHRDERFWPEPCVFDPERFGPERSRHIHPMTYIPFGAGPHGCIGSRLGVLQLK 455
            |.|......|..||||.:.:|:|..|||:|| ....:.:||..:..|.|||..|||.:..:|:||
  Fly   384 PKGASISCLIYMLHRDPKNFPDPERFDPDRF-LVNEKQMHPFAFAAFSAGPRNCIGQKFAMLELK 447

  Fly   456 LGIVHILKQYWVETCERTVSEIRFNPK---SFMLESENEIYLR 495
            ..:..:|:.|      |.:.:....||   ..:.:|.|.|.||
  Fly   448 TSLAMLLRSY------RFLPDKDHQPKPLAELVTKSGNGIRLR 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 110/487 (23%)
Cyp4s3NP_573003.2 p450 35..469 CDD:278495 109/481 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.