DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t3 and Cyp4f39

DIOPT Version :9

Sequence 1:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_796281.1 Gene:Cyp4f39 / 320997 MGIID:2445210 Length:532 Species:Mus musculus


Alignment Length:460 Identity:108/460 - (23%)
Similarity:195/460 - (42%) Gaps:74/460 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 VGFFIFQTPALMVRDPELIRQVL-----IKNFNNFLNRFESADAGDPMGALTLPLAKYHHWKESR 132
            ||.|:   |.|::..|:.|:.||     |...:.|...|.....||  |.|   ::|.:.|...|
Mouse   100 VGPFL---PLLVLVHPDYIKPVLGASAAIAPKDEFFYSFLKPWLGD--GLL---ISKGNKWSRHR 156

  Fly   133 QCMSQLFTSGRMRDVM--YSQMLDVASDLEQYLNRKLGDRLERVLPLGRMCQLYTTDVTGNLFYS 195
            :.::..|....::..|  ::|..::   :.....|.|.:.......:.....|.|.|......:|
Mouse   157 RLLTPAFHFDILKPYMKIFNQCTNI---MHAKWRRHLAEGSVTSFDMFEHISLMTLDSLQKCVFS 218

  Fly   196 LNVGGLRRGRSELITKTKELFNTNPRK------VLDFMSVFFLPKWTGVLKPKVFTEDYARYMRH 254
            .| ...:...|:.|:...||.....|:      .||||  ::|            |.|..|: |.
Mouse   219 YN-SDCQERMSDYISSIIELSALVVRRQYRLHHYLDFM--YYL------------TADGRRF-RQ 267

  Fly   255 LVDDHHEPT-----------------------KGDLINQLQHFQLSRSSNHYSQHPDFVASQAGI 296
            ..|..|..|                       :|..::.:....|::.........:.:.::|..
Mouse   268 ACDTVHNFTTEVIQERRQALRQQGAEAWLKAKQGKTLDFIDVLLLAKDEEGKELSDEDIRAEADT 332

  Fly   297 ILLAGFETSSALMGFTLYELAKAPDIQERLRSELREAF--ISTATLSYDTLMTLPYLKMVCLEAL 359
            .:..|.:|:|:.:.:.|:.|||.|:.||:.|.|::|..  .....|.:|.|..||:..|...|:|
Mouse   333 FMFEGHDTTSSGLSWALFNLAKYPEYQEKCREEIQEVMKGRELEELDWDDLTQLPFTTMCIKESL 397

  Fly   360 RLYPAAAFVNRECTSSASEGFSLQPHVDFIVPPGMPAYISILGLHRDERFWPEPCVFDPERFGPE 424
            |.:|....::|.||    |...|..  ..::|.|:...:||.|.|.:...||:..|::|.||.|:
Mouse   398 RQFPPVTLISRRCT----EDIKLPD--GRVIPKGIICLVSIYGTHHNPIVWPDSKVYNPYRFDPD 456

  Fly   425 RSRHIHPMTYIPFGAGPHGCIGSRLGVLQLKLGIVHILKQYWVETCERTVSEIRFNPKSFMLESE 489
            ..:...|:.::||.|||..|||....:.::::.:...|.::.: :.:|| .::|..|: .:|.:|
Mouse   457 TPQQRSPLAFVPFSAGPRNCIGQSFAMAEMRVVVALTLLRFRL-SVDRT-HKVRRKPE-LILRTE 518

  Fly   490 NEIYL 494
            |.::|
Mouse   519 NGLWL 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 104/450 (23%)
Cyp4f39NP_796281.1 p450 60..515 CDD:365848 104/450 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.