DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t3 and Cyp4g15

DIOPT Version :9

Sequence 1:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_572721.1 Gene:Cyp4g15 / 32093 FlyBaseID:FBgn0030304 Length:574 Species:Drosophila melanogaster


Alignment Length:201 Identity:58/201 - (28%)
Similarity:101/201 - (50%) Gaps:14/201 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   290 VASQAGIILLAGFETSSALMGFTLYELAKAPDIQERLRSELREAF-ISTATLSYDTLMTLPYLKM 353
            :..|...|:..|.:|::|...|.|..:....|||:|:.:||...| .|....::...:.:.||:.
  Fly   369 IKEQVDTIMFEGHDTTAAGSSFFLSLMGIHQDIQDRVLAELDSIFGDSQRPATFQDTLEMKYLER 433

  Fly   354 VCLEALRLYPAAAFVNRECTSSASEGFSLQPHVDFIVPPGMPAYISILGLHRDERFWPEPCVFDP 418
            ..:|.||:||....:.||    ..|...|... ::::|.|....::.:.|||:.:.:..|.||||
  Fly   434 CLMETLRMYPPVPLIARE----LQEDLKLNSG-NYVIPRGATVTVATVLLHRNPKVYANPNVFDP 493

  Fly   419 ERFGPERSRHIHPMTYIPFGAGPHGCIGSRLGVLQLKLGIVHILKQYWVETCERTVSEIRFNPKS 483
            :.|.|||..:.|...::||.|||..|:|.:..:|:||:.:..||:.|      |..|::  ....
  Fly   494 DNFLPERQANRHYYAFVPFSAGPRSCVGRKYAMLKLKILLSTILRNY------RVYSDL--TESD 550

  Fly   484 FMLESE 489
            |.|:::
  Fly   551 FKLQAD 556

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 57/196 (29%)
Cyp4g15NP_572721.1 p450 47..542 CDD:278495 54/183 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.