DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t3 and Cyp4d1

DIOPT Version :9

Sequence 1:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_476907.2 Gene:Cyp4d1 / 31188 FlyBaseID:FBgn0005670 Length:512 Species:Drosophila melanogaster


Alignment Length:497 Identity:106/497 - (21%)
Similarity:189/497 - (38%) Gaps:108/497 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 LLFLRISFGDLFRQLYADPRNGQAKIVG---FFIFQTPALMVR-------------------DPE 89
            ||...:.|..|...:...|......:||   .||.:.|..||:                   .||
  Fly    17 LLLYHLKFKRLIDLISYMPGPPVLPLVGHGHHFIGKPPHEMVKKIFEFMETYSKDQVLKVWLGPE 81

  Fly    90 LIRQVLIKN------------FNNFLNRFESADAGDPMGALTLPLAKYHHWKESRQCMSQLF--- 139
            |  .||:.|            ||:....:::.:.....|.|   :::...|.:.|:.::..|   
  Fly    82 L--NVLMGNPKDVEVVLGTLRFNDKAGEYKALEPWLKEGLL---VSRGRKWHKRRKIITPAFHFK 141

  Fly   140 TSGRMRDVMYSQMLDVASDLEQYLNRKLGDRL---ERVLPLGRMCQLYTTDVTGNLFYSLNVGGL 201
            ...:..:|......|:..::||       |||   :....|.....|.|.|........:::...
  Fly   142 ILDQFVEVFEKGSRDLLRNMEQ-------DRLKHGDSGFSLYDWINLCTMDTICETAMGVSINAQ 199

  Fly   202 RRGRSELITKTKELFNTNPRKVLDFMSVFFLPKWTGVLKPKVFTEDYARYMRHLVDDHHEPTKGD 266
            ....||.:...|.:.....:::.:.:..|.|   |.:|.|      .||..:..::..|:.|: .
  Fly   200 SNADSEYVQAVKTISMVLHKRMFNILYRFDL---TYMLTP------LARAEKKALNVLHQFTE-K 254

  Fly   267 LINQLQHFQLSRSSNHYSQHPDF----------------------------VASQAGIILLAGFE 303
            :|.|.:...:...|:..|.:.|.                            :..:....:..|.:
  Fly   255 IIVQRREELIREGSSQESSNDDADVGAKRKMAFLDILLQSTVDERPLSNLDIREEVDTFMFEGHD 319

  Fly   304 TSSALMGFTLYELAKAPDIQERLRSELREAF--ISTATLSYDTLMTLPYLKMVCLEALRLYPAAA 366
            |:|:.:.|..|.:|..|:.|::...|:|...  ..:..:||:.|..|.|:.:...|.||:||:..
  Fly   320 TTSSALMFFFYNIATHPEAQKKCFEEIRSVVGNDKSTPVSYELLNQLHYVDLCVKETLRMYPSVP 384

  Fly   367 FVNR----ECTSSASEGFSLQPHVDFIVPPGMPAYISILGLHRDERFWPEPCVFDPERFG-PERS 426
            .:.|    :|..:..           ::|.|....||.|.|.|.|..:.||.:|.||||. ...:
  Fly   385 LLGRKVLEDCEINGK-----------LIPAGTNIGISPLYLGRREELFSEPNIFKPERFDVVTTA 438

  Fly   427 RHIHPMTYIPFGAGPHGCIGSRLGVLQLKLGIVHILKQYWVE 468
            ..::|..||||.|||..|||.:..:|::|..:.::|:.|.|:
  Fly   439 EKLNPYAYIPFSAGPRNCIGQKFAMLEIKAIVANVLRHYEVD 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 106/497 (21%)
Cyp4d1NP_476907.2 p450 35..507 CDD:278495 102/479 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.