DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t3 and Cyp4g1

DIOPT Version :9

Sequence 1:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_525031.1 Gene:Cyp4g1 / 30986 FlyBaseID:FBgn0010019 Length:556 Species:Drosophila melanogaster


Alignment Length:551 Identity:120/551 - (21%)
Similarity:213/551 - (38%) Gaps:112/551 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLTIVTLNFWLRHKYDYFRSRGIPHLPPSSWSPM-------GNLGQLLFLRISFGDLFRQLYADP 65
            |:.:....:|.|:..:|   |.:.::|.....|:       ..|.....|.:..|.|        
  Fly    35 LVAMALYEYWRRNSREY---RMVANIPSPPELPILGQAHVAAGLSNAEILAVGLGYL-------- 88

  Fly    66 RNGQAKIVGFFIFQTPALMVRDPELIRQVLIKNFNNFLNRFESADAGDPMGALTLPLAKYHHWKE 130
             |...:.:..::.....:.:.:|..|.  ||.:.:..|.:.|......|.....|.::..|||:.
  Fly    89 -NKYGETMKAWLGNVLLVFLTNPSDIE--LILSGHQHLTKAEEYRYFKPWFGDGLLISNGHHWRH 150

  Fly   131 SRQCMSQLFTSGRMRD-----------VMYSQMLDVAS--DLEQYLNRKLGDRL------ERVLP 176
            .|:.::..|....::.           |:....|:...  |:..|:::...|.|      .:.||
  Fly   151 HRKMIAPTFHQSILKSFVPTFVDHSKAVVARMGLEAGKSFDVHDYMSQTTVDILLSTAMGVKKLP 215

  Fly   177 LGR-----------MCQ---------LYTTD---------VTGNLFYSLNVGGLRRGRSELITKT 212
            .|.           ||.         ||..|         ..|:...::.:|    ..|:::...
  Fly   216 EGNKSFEYAQAVVDMCDIIHKRQVKLLYRLDSIYKFTKLREKGDRMMNIILG----MTSKVVKDR 276

  Fly   213 KELFNTNPRKVLDFMSVFFLPKWTGVLKPKVFTEDYARYMRHLVDDHHEPTKGDLINQLQHFQLS 277
            ||.|....|.:::.:|.           |...|.  |.....|.||..:..:.| :...:...|.
  Fly   277 KENFQEESRAIVEEIST-----------PVASTP--ASKKEGLRDDLDDIDEND-VGAKRRLALL 327

  Fly   278 RSSNHYSQHPDF------VASQAGIILLAGFETSSALMGFTLYELAKAPDIQERLRSELREAF-- 334
            .:....:::||.      :..:...|:..|.:|:||...|.|..:....|||.::.:|.:..|  
  Fly   328 DAMVEMAKNPDIEWNEKDIMDEVNTIMFEGHDTTSAGSSFALCMMGIHKDIQAKVFAEQKAIFGD 392

  Fly   335 --ISTATLSYDTLMTLPYLKMVCLEALRLYPAAAFVNR--ECTSSASEGFSLQPHVDFIVPPGMP 395
              :...|.: || |.:.||:.|.||.|||||....:.|  :.....:.|       .:.||.|..
  Fly   393 NMLRDCTFA-DT-MEMKYLERVILETLRLYPPVPLIARRLDYDLKLASG-------PYTVPKGTT 448

  Fly   396 AYISILGLHRDERFWPEPCVFDPERFGPERSRHIHPMTYIPFGAGPHGCIGSRLGVLQLKLGIVH 460
            ..:....:||....:|.|..|||:.|.|||..:.|..::|||.|||..|:|.:..:|:||:.:..
  Fly   449 VIVLQYCVHRRPDIYPNPTKFDPDNFLPERMANRHYYSFIPFSAGPRSCVGRKYAMLKLKVLLST 513

  Fly   461 ILKQYWVETCERTVSEIRFNPKS-FMLESEN 490
            |::.|.|.:   |.:|..|..:: .:|:.||
  Fly   514 IVRNYIVHS---TDTEADFKLQADIILKLEN 541

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 112/519 (22%)
Cyp4g1NP_525031.1 p450 58..518 CDD:278495 107/497 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.