DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t3 and Cyp4f39

DIOPT Version :9

Sequence 1:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster
Sequence 2:XP_006241152.1 Gene:Cyp4f39 / 299566 RGDID:1308796 Length:550 Species:Rattus norvegicus


Alignment Length:476 Identity:107/476 - (22%)
Similarity:201/476 - (42%) Gaps:106/476 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 VGFFIFQTPALMVRDPELIRQVL-----IKNFNNFLNRFESADAGDPMGALTLPLAKYHHWKESR 132
            ||.|:   |.|::..|:.|:.||     |...:.|...|.....||  |.|   ::|.:.|...|
  Rat   100 VGPFL---PLLVLVHPDYIKPVLGASAAIAPKDEFFYSFLKPWLGD--GLL---ISKGNKWSRHR 156

  Fly   133 QCMSQLFTSGRMRDVM--YSQMLDV---------------ASDLEQYLNRKLGDRLERVLPLGRM 180
            :.::..|....::..|  ::|.:::               :.|:.::::....|.|::       
  Rat   157 RLLTPAFHFDILKPYMKIFNQSVNIMHAKWRRHLAEGSVTSFDMFEHVSLMTLDSLQK------- 214

  Fly   181 CQL-YTTDVTGNLFYSLNVGGLRRGRSELITKTKELFNTNPRK------VLDFMSVFFLPKWTGV 238
            |.. |::|....|             |:.|:...||.....|:      .|||  :::|      
  Rat   215 CVFSYSSDCQEKL-------------SDYISSIIELSALVVRRQYRLHHYLDF--IYYL------ 258

  Fly   239 LKPKVFTEDYARYMRHLVDDHHEPT-----------------------KGDLINQLQHFQLSRSS 280
                  |.|..|: |...|..|..|                       :|..::.:....|::..
  Rat   259 ------TADGRRF-RQACDTVHNFTTEVIQQRRRALRELGAEAWLKAKQGKTLDFIDVLLLAKDE 316

  Fly   281 NHYSQHPDFVASQAGIILLAGFETSSALMGFTLYELAKAPDIQERLRSELREAF--ISTATLSYD 343
            .......:.:.::|...:..|.:|:|:.:.:.|:.|||.|:.|::.|.|::|..  .....|.:|
  Rat   317 EGKELSDEDIRAEADTFMFEGHDTTSSGLSWALFNLAKYPEYQDKCREEIQEVMKGRELEELDWD 381

  Fly   344 TLMTLPYLKMVCLEALRLYPAAAFVNRECTSSASEGFSLQPHVDFIVPPGMPAYISILGLHRDER 408
            .|..||:..|...|:||.:|....::|.||    |...|..  ..|:|.|:...:||.|.|.:..
  Rat   382 DLTQLPFTTMCIKESLRQFPPVTLISRRCT----EDIKLPD--GRIIPKGIICLVSIYGTHYNPL 440

  Fly   409 FWPEPCVFDPERFGPERSRHIHPMTYIPFGAGPHGCIGSRLGVLQLKLGIVHILKQYWVETCERT 473
            .||:..|::|.||.|:..:...|:.::||.|||..|||....:.::::.:...|.::.: :.:||
  Rat   441 VWPDSKVYNPYRFDPDIPQQRSPLAFVPFSAGPRNCIGQSFAMAEMRVVVALTLLRFRL-SVDRT 504

  Fly   474 VSEIRFNPKSFMLESENEIYL 494
             .::|..|: .:|.:||.::|
  Rat   505 -RKVRRKPE-LILRTENGLWL 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 103/466 (22%)
Cyp4f39XP_006241152.1 CYP4F 82..523 CDD:410772 106/474 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.