DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t3 and Cyp4f18

DIOPT Version :9

Sequence 1:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001028858.2 Gene:Cyp4f18 / 290623 RGDID:1305261 Length:524 Species:Rattus norvegicus


Alignment Length:575 Identity:137/575 - (23%)
Similarity:223/575 - (38%) Gaps:162/575 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WLLLLTI---VTLNFWLRHKYDYF----RSRGIPHLPPSSWSPMGNLG-------QLLFLRISFG 55
            |||||.:   ..|.:.|...|..|    |.|..|..|..:|. .|:||       .||::: |..
  Rat    19 WLLLLLVGASCLLAYILPQVYAVFENSRRLRRFPQPPTRNWL-FGHLGLIQSSEEGLLYIQ-SLS 81

  Fly    56 DLFRQL---YADPRNGQAKIVGFFIFQTPALMVRDPELIRQVLI---------KNFNNFLNRFES 108
            ..||.:   :..|.:             |.:.:..|..|:.|::         :.|..||..:  
  Rat    82 RTFRDVCCWWVGPWH-------------PVIRIFHPAFIKPVILAPASVAPKDRVFYRFLKPW-- 131

  Fly   109 ADAGDPMGALTLPLAKYHHWKESRQCMSQLFTSGRMR----------DVMYSQMLDVAS------ 157
              .||  |.|   |:....|...|..::..|....::          ::|:::...:||      
  Rat   132 --LGD--GLL---LSTGDKWSRHRHMLTPAFHFNILKPYVKIFNDSTNIMHAKWQRLASQGSARL 189

  Fly   158 DLEQYLNRKLGDRLER-VLPLGRMCQ----LYTTDVTG----------------NLFYSLNVGGL 201
            |:.::::....|.|:: |......||    .|.|.:..                :|||.|...|:
  Rat   190 DMFEHISLMTLDSLQKCVFSFDSNCQEKPSEYITAILELSALVARRHQSLLLYVDLFYHLTRDGM 254

  Fly   202 R-RGRSELI-----TKTKELFNTNP-------------RKVLDFMSVFFLPKWTGVLKPKVFTED 247
            | |....|:     ...:|...|.|             .|.|||:.|..|.|             
  Rat   255 RFRKACRLVHDFTDAVIRERRRTLPDQGGDDALKAKAKAKTLDFIDVLLLSK------------- 306

  Fly   248 YARYMRHLVDDHHEPTKGDLINQLQHFQLSRSSNHYSQHPDFVASQAGIILLAGFETSSALMGFT 312
                     |:|.|....:.|.                      ::|...:..|.:|:::.:.:.
  Rat   307 ---------DEHGEALSDEDIR----------------------AEADTFMFGGHDTTASGLSWI 340

  Fly   313 LYELAKAPDIQERLRSELREAF--ISTATLSYDTLMTLPYLKMVCLEALRLYPAAAFVNRECTSS 375
            ||.|||.|:.|||.|.|:||..  .....:.:|.|..||:|.|...|:|||:|.|..::|.||..
  Rat   341 LYNLAKHPEYQERCRQEVRELLRDREPEEIEWDDLAQLPFLTMCIKESLRLHPPATAISRCCTQD 405

  Fly   376 ASEGFSLQPHVDFIVPPGMPAYISILGLHRDERFWPEPCVFDPERFGPERSRHIHPMTYIPFGAG 440
            .     :.|. ..::|.|:...|||.|.|.:...||:|.|::|.||..:......|:.:|||.||
  Rat   406 I-----MLPD-GRVIPKGVICRISIFGTHHNPAVWPDPEVYNPFRFDADNGEGRSPLAFIPFSAG 464

  Fly   441 PHGCIGSRLGVLQLKLGIVHILKQYWVETCERTVSEIRFNPKSFMLESENEIYLR 495
            |..|||....:.::|:.:...|.::.|...::   |.|..|: .:|.:|..::||
  Rat   465 PRNCIGQTFAMSEMKVALALTLLRFRVLPDDK---EPRRKPE-LILRAEGGLWLR 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 121/528 (23%)
Cyp4f18NP_001028858.2 CYP4F 74..515 CDD:410772 118/517 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.