DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t3 and Cyp4f4

DIOPT Version :9

Sequence 1:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_775146.1 Gene:Cyp4f4 / 286904 RGDID:708363 Length:522 Species:Rattus norvegicus


Alignment Length:578 Identity:137/578 - (23%)
Similarity:224/578 - (38%) Gaps:164/578 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LIWLLLLTIVTLNFW-----LRHKYDYFRSR----GIPHLPPSSWSPMGNLGQLLFLRISFGDLF 58
            |.|||||.|..  .|     |...|.::|:.    ..|..|..:|. :|:||.:.........:.
  Rat    17 LPWLLLLLIGA--SWLLVRVLTQTYIFYRTYQHLCDFPQPPKWNWF-LGHLGMITPTEQGLKQVT 78

  Fly    59 RQLYADPRNGQAKIVGFFIFQTPALMV---RDPELIRQVLIKN---------FNNFLNRFESADA 111
            :.:...|:       ||..:..|.|.:   ..|::||.||..:         |.:||..:    .
  Rat    79 KLVATYPQ-------GFMTWLGPILPIITLCHPDVIRSVLSASASVALKEVIFYSFLKPW----L 132

  Fly   112 GDPMGALTLPLAKYHHWKESRQCMSQLFTSGRMR----------DVMYSQMLDVASD----LEQY 162
            ||  |.|   |:....|...|:.::..|....::          ::|:::..|:||.    |:.:
  Rat   133 GD--GLL---LSDGDKWSCHRRMLTPAFHFNILKPYVKIFNDSTNIMHAKWQDLASGGSARLDMF 192

  Fly   163 LNRKLG--DRLER-VLPLGRMCQ------------------------LYTTDVTGNLFYSLNVGG 200
            .|..|.  |.|:: |......||                        |..||    ..|.|...|
  Rat   193 KNISLMTLDSLQKCVFSFDSNCQEKPSEYISAILELSALVAKRYQQLLLHTD----SLYQLTHNG 253

  Fly   201 LR----------------RGRSELITKTKE--LFNTNPR-KVLDFMSVFFLPKWTGVLKPKVFTE 246
            .|                :||...:....|  :.....| |.|||:.|..|            |:
  Rat   254 RRFHKACKLVHNFTDAVIQGRRRALPSQHEDDILKAKARSKTLDFIDVLLL------------TK 306

  Fly   247 DYARYMRHLVDDHHEPTKGDLINQLQHFQLSRSSNHYSQHPDFVASQAGIILLAGFETSSALMGF 311
            |         :|..|.:..|                       :.::|...:..|.:|:::.:.:
  Rat   307 D---------EDGKELSDED-----------------------IRAEADTFMFEGHDTTASGLSW 339

  Fly   312 TLYELAKAPDIQERLRSELREAF--ISTATLSYDTLMTLPYLKMVCLEALRLYPAAAFVNRECTS 374
            .||.||:.|:.|||.|.|:||..  ..:..:.:|.|..||:|.|...|:|||:|....::|.||.
  Rat   340 ILYNLARHPEYQERCRQEVRELLRDRESTEIEWDDLAQLPFLTMCIKESLRLHPPVTVISRRCTQ 404

  Fly   375 S--ASEGFSLQPHVDFIVPPGMPAYISILGLHRDERFWPEPCVFDPERFGPERSRHIHPMTYIPF 437
            .  ..:|        .::|.|:...|:|...|.:...||:|.|:||.||.||..:...|:.:|||
  Rat   405 DIVLPDG--------RVIPKGVICIINIFATHHNPTVWPDPEVYDPFRFDPENIKDRSPLAFIPF 461

  Fly   438 GAGPHGCIGSRLGVLQLKLGIVHILKQYWVETCERTVSEIRFNPKSFMLESENEIYLR 495
            .|||..|||....:.::|:.:...|.::.|...::   |.|..|: .:|.:|..::||
  Rat   462 SAGPRNCIGQTFAMNEMKVALALTLLRFRVLPDDK---EPRRKPE-LILRAEGGLWLR 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 121/527 (23%)
Cyp4f4NP_775146.1 CYP4F 74..515 CDD:410772 118/516 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.