DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t3 and CYP4V2

DIOPT Version :9

Sequence 1:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_997235.3 Gene:CYP4V2 / 285440 HGNCID:23198 Length:525 Species:Homo sapiens


Alignment Length:493 Identity:112/493 - (22%)
Similarity:201/493 - (40%) Gaps:85/493 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 LGQLLFLRISFGDLFRQL--YADPRNGQAKIVGFFIFQTPALMVRDPELIRQVLI-------KNF 99
            :|..|.::....:.|:|:  |.:... ...::..::...|.:.:.:.|.:..:|.       .:.
Human    60 VGHALLMKPDGREFFQQIIEYTEEYR-HMPLLKLWVGPVPMVALYNAENVEVILTSSKQIDKSSM 123

  Fly   100 NNFLNRFESADAGDPMGALTLPLAKYHHWKESRQCMSQLFTSGRMR---DVMYSQMLDVASDLEQ 161
            ..||         :|...|.|..:..:.|:..|:.::..|....:.   |:|..|...:...||:
Human   124 YKFL---------EPWLGLGLLTSTGNKWRSRRKMLTPTFHFTILEDFLDIMNEQANILVKKLEK 179

  Fly   162 YLNRKLGDRLERVLPLGRMCQLYTT----DVTGNLFYSLNVGGLRRGRSELITKTKELFNTNPRK 222
            ::|::..:           |..|.|    |:........|:|......||.:.....:.....|:
Human   180 HINQEAFN-----------CFFYITLCALDIICETAMGKNIGAQSNDDSEYVRAVYRMSEMIFRR 233

  Fly   223 V------LDFMSVFFLPKWTGVLKPKV---FTEDYARYMRHLVDDHHE---------PTKG---- 265
            :      ||...:.|...|......::   ||........:.::.:.:         |:|.    
Human   234 IKMPWLWLDLWYLMFKEGWEHKKSLQILHTFTNSVIAERANEMNANEDCRGDGRGSAPSKNKRRA 298

  Fly   266 --DLINQLQHFQLSRSSNHYSQHPDFVASQAGIILLAGFETSSALMGFTLYELAKAPDIQERLRS 328
              ||:..:...:.:|.|     |.| :..:....:..|.:|::|.:.::||.|...|::|:::..
Human   299 FLDLLLSVTDDEGNRLS-----HED-IREEVDTFMFEGHDTTAAAINWSLYLLGSNPEVQKKVDH 357

  Fly   329 ELREAF-ISTATLSYDTLMTLPYLKMVCLEALRLYPAAAFVNRECTSSASEGFSLQPHVDFIVPP 392
            ||.:.| .|....:.:.|..|.||:.|..|.|||:|:.....|    |.||...:   ..:.|..
Human   358 ELDDVFGKSDRPATVEDLKKLRYLECVIKETLRLFPSVPLFAR----SVSEDCEV---AGYRVLK 415

  Fly   393 GMPAYISILGLHRDERFWPEPCVFDPERFGPERSRHIHPMTYIPFGAGPHGCIGSRLGVLQLKLG 457
            |..|.|....||||.|::|.|..|.||||.||.::..||..|:||.|||..|||.:..|::.|..
Human   416 GTEAVIIPYALHRDPRYFPNPEEFQPERFFPENAQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTI 480

  Fly   458 IVHILKQYWVETCERTVSEIRFNPKSFMLESENEIYLR 495
            :..||:.:|:|:          |.|...|..|.::.||
Human   481 LSCILRHFWIES----------NQKREELGLEGQLILR 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 108/482 (22%)
CYP4V2NP_997235.3 p450 55..517 CDD:278495 112/493 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.