DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t3 and Cyp4f6

DIOPT Version :9

Sequence 1:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster
Sequence 2:XP_006241111.1 Gene:Cyp4f6 / 266689 RGDID:708365 Length:538 Species:Rattus norvegicus


Alignment Length:546 Identity:133/546 - (24%)
Similarity:219/546 - (40%) Gaps:104/546 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WLLLL------TIVTLNFWLRHKYD-YFRSRGIPHLPPSSW-----SPMGNLGQLLFLRISFGDL 57
            |.|||      .:..:..|:...|| ..|.|..|..|..||     :.|.|..:.:......|..
  Rat    20 WHLLLLGGASWILARILAWIYTFYDNCCRLRCFPQPPKPSWFWGHLTLMKNNEEGMQFIAHLGRN 84

  Fly    58 FRQLYADPRNGQAKIVGFFIFQTPALMVRDPELIRQVL-----IKNFNNFLNRFESADAGDPMGA 117
            ||.::       ...||...   |.|.:..|.:|..:|     :......|..|.....||  |.
  Rat    85 FRDIH-------LSWVGPVY---PILRLVHPNVIAPLLQASAAVAPKEMTLYGFLKPWLGD--GL 137

  Fly   118 LTLPLAKYHHWKESRQCMSQLFTSGRMRDV--MYSQMLDVASDLEQYLNRKLGDRLERVLPLGRM 180
            |   ::....|...|:.::..|....::..  ::::.::......|.|..|...||:    :...
  Rat   138 L---MSAGEKWNHHRRLLTPAFHFDILKSYVKIFNKSVNTMHAKWQRLTAKGSARLD----MFEH 195

  Fly   181 CQLYTTDVTGNLFYSLNVGGLRRGRSELITKTKELFN------TNPRKVLDFMSVFFLP------ 233
            ..|.|.|......:|.: ...:...||.|....||.:      ..|...|||:  ::|.      
  Rat   196 ISLMTLDSLQKCIFSFD-SNCQESNSEYIAAILELSSLIVKRQRQPFLYLDFL--YYLTADGRRF 257

  Fly   234 -KWTGVLKPKVFTEDYARYMRHLVDDHHEPTKG--------------DLINQLQHFQLSRSSNHY 283
             |...|:..  ||:...|..|..::     |:|              |.|:.|    |.....|.
  Rat   258 RKACDVVHN--FTDAVIRERRSTLN-----TQGVDEFLKARAKTKTLDFIDVL----LLAKDEHG 311

  Fly   284 SQHPDF-VASQAGIILLAGFETSSALMGFTLYELAKAPDIQERLRSELREAF--ISTATLSYDTL 345
            ....|. :.::|...:..|.:|:::.:.:.||.||:.|:.|||.|.|:||..  .....:.:|.|
  Rat   312 KGLSDVDIRAEADTFMFGGHDTTASALSWILYNLARHPEYQERCRQEVRELLRDREPEEIEWDDL 376

  Fly   346 MTLPYLKMVCLEALRLYPAAAFVNRECTSSASEGFSLQPHVDFIVPPG--MP----AYISILGLH 404
            ..||:|.|...|:|||:|....::|.|:.            |.::|.|  :|    ..|||.|:|
  Rat   377 AQLPFLTMCIKESLRLHPPVLLISRCCSQ------------DIVLPDGRVIPKGNICVISIFGVH 429

  Fly   405 RDERFWPEPCVFDPERFGPERSRHIHPMTYIPFGAGPHGCIGSRLGVLQLKLGIVHILKQYWVET 469
            .:...||:|.|::|.||.||..:...|:.:|||.|||..|||....:.::|:.:...|.::.|..
  Rat   430 HNPSVWPDPEVYNPFRFDPENPQKRSPLAFIPFSAGPRNCIGQTFAMSEIKVALALTLLRFCVLP 494

  Fly   470 CERTVSEIRFNPKSFMLESENEIYLR 495
            .::   |.|..|: .:|.:|..::||
  Rat   495 DDK---EPRRKPE-LILRAEGGLWLR 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 119/499 (24%)
Cyp4f6XP_006241111.1 p450 53..515 CDD:278495 122/510 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.