DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t3 and Cyp4a8

DIOPT Version :9

Sequence 1:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster
Sequence 2:XP_038965258.1 Gene:Cyp4a8 / 266674 RGDID:628846 Length:510 Species:Rattus norvegicus


Alignment Length:577 Identity:123/577 - (21%)
Similarity:214/577 - (37%) Gaps:179/577 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LIWLLLLTIVTLNFWLRHKYDYFRSRGIPHLPPSSWSPMGNLGQLLFLRISFGDLFRQLYADPRN 67
            ::.:|||...|..|:|..::....::..|. |||.|. .|:  :|.||   ....|:.:....:|
  Rat    24 VLTVLLLLFKTAQFYLHRRWLLRATQQFPS-PPSHWF-FGH--KLSFL---VDQEFQDILTRVKN 81

  Fly    68 GQAKIVGFFIFQTPALMVRDPELIRQVLIKNFNNFLNRFESADAGDPMGALTLPLAKYHH----- 127
            ..:....:.......:.|.||:.::.:|.::              ||         |.||     
  Rat    82 FPSACPQWLWGSNVRIQVYDPDYMKLILGRS--------------DP---------KSHHSYRFL 123

  Fly   128 ---------------WKESRQCMSQLF-------TSGRMRDVM------YSQMLDVASDLEQY-- 162
                           |.:.|:.::..|       ..|.|.|.:      :.|::...|.||.:  
  Rat   124 APWIGYGLLLLNGQTWFQHRRMLTPAFHYDTLKPYVGIMADSVRIMLDKWEQIVGQDSTLEIFQH 188

  Fly   163 ---------------------LNRKLGDRLERVLPLGRMCQLYTTDV--TGNLFYSLNVGGLRRG 204
                                 |:||....::.|..|..:......::  ..::.|||:..| |:.
  Rat   189 ITLMTLDTIMKCAFSQEGSVQLDRKYKSYIKAVEDLNNLSFFRIRNIFHQNDIIYSLSSNG-RKA 252

  Fly   205 RS----------ELITKTK-------ELFNTNPRKVLDFMSVFFLPKWTGVLKPKVFTEDYARYM 252
            ||          ::|...|       ||.....::.|||:.:..                     
  Rat   253 RSAWQLAHEHTDQVIKSRKAQLQDEEELQKVKQKRRLDFLDILL--------------------- 296

  Fly   253 RHLVDDHHEPTKGDLINQLQHFQLSRSSNHYSQHPDFVASQAGIILLAGFETSSALMGFTLYELA 317
                                   .:|..|..|.....:.::....:..|.:|:::.:.:..|.||
  Rat   297 -----------------------FARIENGSSLSDKDLRAEVDTFMFEGHDTTASGISWIFYALA 338

  Fly   318 KAPDIQERLRSELREAFISTATLSYDTLMTLPYLKMVCLEALRLYPAAAFVNRECTSSAS--EGF 380
            ..|:.|:..|.|::......|::::|.|..:||..|...||||:||....|:|..::..:  :|.
  Rat   339 TNPEHQQGCRKEIQSLLGDGASITWDDLDKMPYTTMCIKEALRIYPPVTAVSRMLSTPVTFPDGR 403

  Fly   381 SLQPHVDFIVPPGMPAYISILGLHRDERFWPEPCVFDPERFGPERSRHIHPMTYIPFGAGPHGCI 445
            ||        |.|:...:|..|||.:...||.|.||||.||.||.|||.|  :::||..|...||
  Rat   404 SL--------PKGITVMLSFYGLHHNPTVWPNPEVFDPYRFAPESSRHSH--SFLPFSGGARNCI 458

  Fly   446 GSRLGVLQLKLGIVHILKQYWVETCERTVSEIRFNP-------KSFMLESENEIYLR 495
            |.:..:.:||:.:...|.::          |:..:|       ...:|:|:|.||||
  Rat   459 GKQFAMNELKVAVALTLLRF----------ELLPDPTRIPIPIPRLVLKSKNGIYLR 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 109/535 (20%)
Cyp4a8XP_038965258.1 CYP4B-like 72..505 CDD:410771 106/520 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.