DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t3 and CYP4X1

DIOPT Version :9

Sequence 1:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_828847.1 Gene:CYP4X1 / 260293 HGNCID:20244 Length:509 Species:Homo sapiens


Alignment Length:551 Identity:136/551 - (24%)
Similarity:224/551 - (40%) Gaps:121/551 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLLLTIVTLNFWLRHKYDYFRSRGIPHLPPSSWSPMGNLGQLLFLRISFGDLFRQLYAD-PRNGQ 69
            |.|..:..:..:||.:......|..| .||:.|.    ||...|::....:...::... ||...
Human    22 LALGLLQAIKLYLRRQRLLRDLRPFP-APPTHWF----LGHQKFIQDDNMEKLEEIIEKYPRAFP 81

  Fly    70 AKIVGFFIFQTPALMVRDPELIRQVLIKN--FNNFLNRFESADAGDPMGALTLPLAKYHHWKESR 132
            ..|..|..|    ..:.||:..:.:|.:.  .:.:|.:|.....|..:.||..|     .|.:.|
Human    82 FWIGPFQAF----FCIYDPDYAKTLLSRTDPKSQYLQKFSPPLLGKGLAALDGP-----KWFQHR 137

  Fly   133 QCMSQLFTSGRMRDVMYSQMLDVASDLEQYLNRKLGDRLERVLPLGRMCQLYTTDVTGNLFYSLN 197
                :|.|.|...:::.:.:..:|..::..|     |:.|::      |.  |.|.:..::..:|
Human   138 ----RLLTPGFHFNILKAYIEVMAHSVKMML-----DKWEKI------CS--TQDTSVEVYEHIN 185

  Fly   198 VGGLRRGRSELITK---TKEL-FNTNPRKVLDFMSVFFLPKWTGVLKPKVFTEDYARYMRHLVDD 258
            ...|     ::|.|   :||. ..||........::|.|.|   ::..::::..|          
Human   186 SMSL-----DIIMKCAFSKETNCQTNSTHDPYAKAIFELSK---IIFHRLYSLLY---------- 232

  Fly   259 HHEPTKGDLINQLQ----HFQ-LSRSSNHYS-----------------------QHPDF------ 289
                 ..|:|.:|.    .|| |||..|.|:                       ::.||      
Human   233 -----HSDIIFKLSPQGYRFQKLSRVLNQYTDTIIQERKKSLQAGVKQDNTPKRKYQDFLDIVLS 292

  Fly   290 -------------VASQAGIILLAGFETSSALMGFTLYELAKAPDIQERLRSELREAFISTATLS 341
                         |.|:....||||.:|.:|.:.:.||.||..|:.|||.|.|:|......::::
Human   293 AKDESGSSFSDIDVHSEVSTFLLAGHDTLAASISWILYCLALNPEHQERCREEVRGILGDGSSIT 357

  Fly   342 YDTLMTLPYLKMVCLEALRLYPAAAFVNRECTSSAS--EGFSLQPHVDFIVPPGMPAYISILGLH 404
            :|.|..:.|..|...|..||.||...::|:.:...:  :|.:|        |.|:...:||.|||
Human   358 WDQLGEMSYTTMCIKETCRLIPAVPSISRDLSKPLTFPDGCTL--------PAGITVVLSIWGLH 414

  Fly   405 RDERFWPEPCVFDPERFGPERSRHIHPMTYIPFGAGPHGCIGSRLGVLQLKLGIVHILKQYWVET 469
            .:...|..|.||||.||..|.|...||..|:||.||...|||....:::||:.|..||..:.| |
Human   415 HNPAVWKNPKVFDPLRFSQENSDQRHPYAYLPFSAGSRNCIGQEFAMIELKVTIALILLHFRV-T 478

  Fly   470 CERTVSEIRFNPKSFMLESENEIYLRFCRSS 500
            .:.| ..:.| |..|:|:.:|.:||...:.|
Human   479 PDPT-RPLTF-PNHFILKPKNGMYLHLKKLS 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 125/507 (25%)
CYP4X1NP_828847.1 p450 47..501 CDD:306555 128/518 (25%)
heme binding region 447..460 6/12 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.