DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t3 and Cyp3a23-3a1

DIOPT Version :9

Sequence 1:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_037237.2 Gene:Cyp3a23-3a1 / 25642 RGDID:628626 Length:502 Species:Rattus norvegicus


Alignment Length:511 Identity:143/511 - (27%)
Similarity:240/511 - (46%) Gaps:51/511 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WLLLLTIVTL--NFWLRHKYDYFRSRGIPHLPPSSWSPMGNLGQLLFLRISFGDLFRQLY---AD 64
            |:||..::.|  .|..| .:..|:.:|||     ...|:...|.:|       :.:..|:   .:
  Rat    12 WVLLAVVLVLLYGFGTR-THGLFKKQGIP-----GPKPLPFFGTVL-------NYYMGLWKFDVE 63

  Fly    65 PRNGQAKIVGFFIFQTPALMVRDPELIRQVLIKN-FNNFLNRFESADAGDPMGAL--TLPLAKYH 126
            ......||.|.|..|.|...:.|.|:|:.||:|. |:.|.||   .|.| |:|.:  .:.::|..
  Rat    64 CHKKYGKIWGLFDGQMPLFAITDTEMIKNVLVKECFSVFTNR---RDFG-PVGIMGKAISVSKDE 124

  Fly   127 HWKESRQCMSQLFTSGRMRDVMYSQMLDVASDLEQYLNRKLGDRLERVLPLGRMCQLYTTDVTGN 191
            .||..|..:|..|||||::: |:..:......|.:||.::.|    :.:|:..:...|:.||..:
  Rat   125 EWKRYRALLSPTFTSGRLKE-MFPVIEQYGDILVKYLRQEKG----KPVPVKEVFGAYSMDVITS 184

  Fly   192 LFYSLNVGGLRRGRSELITKTKELFNTNPRKVLDFMSVFFLPKWTGVLK-------PKVFTEDYA 249
            ..:.:||..|...:...:.|.|:|...:....| |:||...|..|.|.:       ||...|.:.
  Rat   185 TSFGVNVDSLNNPKDPFVEKAKKLLRIDFFDPL-FLSVVLFPFLTPVYEMLNICMFPKDSIEFFK 248

  Fly   250 RYMRHLVDDHHEPTKGDLINQLQ-----HFQLSRSSNHYSQHPDFVASQAGIILLAGFETSSALM 309
            :::..:.:...:..:...::.||     |.......:|.:.....:.:|:.|.:.||:|.:|:.:
  Rat   249 KFVYRMKETRLDSVQKHRVDFLQLMMNAHNDSKDKESHTALSDMEITAQSIIFIFAGYEPTSSTL 313

  Fly   310 GFTLYELAKAPDIQERLRSELREAFISTATLSYDTLMTLPYLKMVCLEALRLYPAAAFVNRECTS 374
            .|.|:.||..||.|::|:.|:..|..:.|..:|||:|.:.||.||..|.|||||....:.|.|..
  Rat   314 SFVLHSLATHPDTQKKLQEEIDRALPNKAPPTYDTVMEMEYLDMVLNETLRLYPIGNRLERVCKK 378

  Fly   375 SASEGFSLQPHVDFIVPPGMPAYISILGLHRDERFWPEPCVFDPERFGPERSRHIHPMTYIPFGA 439
            .........|....::   :|:|    .||||.:.||||..|.||||..|....|.|..|:|||.
  Rat   379 DVEINGVFMPKGSVVM---IPSY----ALHRDPQHWPEPEEFRPERFSKENKGSIDPYVYLPFGN 436

  Fly   440 GPHGCIGSRLGVLQLKLGIVHILKQYWVETCERTVSEIRFNPKSFMLESENEIYLR 495
            ||..|||.|..::.:||.:..:|:.:..:.|:.|...::.: :..:|:....|.|:
  Rat   437 GPRNCIGMRFALMNMKLALTKVLQNFSFQPCKETQIPLKLS-RQGLLQPTKPIILK 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 130/469 (28%)
Cyp3a23-3a1NP_037237.2 p450 39..492 CDD:278495 134/483 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X40
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.