DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t3 and erg5

DIOPT Version :9

Sequence 1:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_593788.2 Gene:erg5 / 2542469 PomBaseID:SPAC19A8.04 Length:543 Species:Schizosaccharomyces pombe


Alignment Length:478 Identity:109/478 - (22%)
Similarity:187/478 - (39%) Gaps:93/478 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 YD---YFRSRGIPHLP-PSSWSP-MGNLGQLLFLRISFGDLFRQLYADPRNGQAKIVGFFIFQTP 81
            ||   |...:|  |:| |....| ||:     ||. |....|.:..|..:.|....|.  :|...
pombe    42 YDQISYQMQKG--HIPGPRFKIPFMGS-----FLD-SMKPTFEKYNAKWQTGPLSCVS--VFHKF 96

  Fly    82 ALMVRDPELIRQVLIKNFNNFLNRFESADAGDPMGALTLPLAKYHHWK--------ESRQCMSQL 138
            .::..:.:|.|::|  |..:::... ..|||.       .:.|:.:|.        |.|:.::.|
pombe    97 VVIASERDLARKIL--NSPSYVQPC-VVDAGK-------KILKHTNWVFLDGRDHIEYRKGLNGL 151

  Fly   139 FTSGRMRDVMYSQMLDVASDLEQYLNRKLGDRLERVLP-----LGRMCQLYTTDVTGNLFYSLNV 198
            ||:..:...:.:|........:::|.....|..:.::|     :...|:.:..       |.::.
pombe   152 FTTRALASYLPAQEAVYNKYFKEFLAHSKDDYAQYMIPFRDINVATSCRTFCG-------YYISD 209

  Fly   199 GGLRRGRSEL--ITKTKELFNTNPRKVLDFMSVFFLPKWTGVLKPKVFTEDYARYMRHLVDDHHE 261
            ..::....|.  ||...||.|.  ..||.|..|     |.|:...||       .||:.:....|
pombe   210 DAIKHIADEYWKITAAMELVNF--PIVLPFTKV-----WYGIQSRKV-------VMRYFMKAAAE 260

  Fly   262 PTKG------------DLINQLQHFQLSRSSN-HYSQHP-----DFVASQAGI----ILLAGFET 304
            ..|.            :.|:::...:..:|.| ..::.|     :|...:..:    .|.|..:.
pombe   261 SRKNMEAGNAPACMMEEWIHEMIETRKYKSENKEGAEKPSVLIREFSDEEISLTFLSFLFASQDA 325

  Fly   305 SSALMGFTLYELAKAPDIQERLRSE---LREAFISTATLSYDTLMTLPYLKMVCLEALRLYPAAA 366
            :|:.|.:....||..||:.:::|.|   :|:..|. ..||.|.:..:.|.:.|..|.|||.|...
pombe   326 TSSAMTWLFQLLADHPDVLQKVREEQLRIRKGDID-VPLSLDLMEKMTYTRAVVKECLRLRPPVL 389

  Fly   367 FVNRECTSSASEGFSLQPHVDFIVPPGMPAYISILGLHRDERFWPEPCVFDPERFGPERSRHIHP 431
            .|    .....:.|.:.|  |:.||.......::.|...|.:.:|||..|:|:|:.|.......|
pombe   390 MV----PYRVKKAFPITP--DYTVPKDAMVIPTLYGALHDSKVYPEPETFNPDRWAPNGLAEQSP 448

  Fly   432 MTYIPFGAGPHGCIGSRLGVLQL 454
            ..::.||.|||.|:|.|..|..|
pombe   449 KNWMVFGNGPHVCLGQRYAVNHL 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 104/463 (22%)
erg5NP_593788.2 CypX 57..505 CDD:225035 103/461 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 88 1.000 Domainoid score I2119
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 88 1.000 Inparanoid score I1773
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X40
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.