DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t3 and Cyp19a1

DIOPT Version :9

Sequence 1:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_058781.2 Gene:Cyp19a1 / 25147 RGDID:2457 Length:503 Species:Rattus norvegicus


Alignment Length:517 Identity:103/517 - (19%)
Similarity:202/517 - (39%) Gaps:133/517 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 PMGNLGQLLFLRI-SFGDLFRQLYADPRNGQAKIVGFFIFQTPALMVRDPELIRQVLIKNFNNFL 103
            |:.:.|:.|::.| |..:.:.::|.:       .:..:|.....|::....  ..|.:...:|::
  Rat    58 PLISHGRFLWMGIGSACNYYNKMYGE-------FMRVWISGEETLIISKSS--SMVHVMKHSNYI 113

  Fly   104 NRFESADAGDPMGALTLPLAKYHH-----------WKESRQCMSQLFTS-GRMRDVMYSQMLDV- 155
            :||     |...|   |.....|.           |:..|....:..|. |.:|      |::| 
  Rat   114 SRF-----GSKRG---LQCIGMHENGIIFNNNPSLWRTVRPFFMKALTGPGLIR------MVEVC 164

  Fly   156 ASDLEQYLNRKLGDRLER-----VLPLGRMCQLYTTDVTGNLFYSLNVGGLRRGRSELITKTKEL 215
            ...::|:|:| |||..:.     |:.|.|...|   |.:..||.     |:....|.::.|.:..
  Rat   165 VESIKQHLDR-LGDVTDNSGYVDVVTLMRHIML---DTSNTLFL-----GIPLDESSIVKKIQGY 220

  Fly   216 FNTNPRKVLDFMSVFFLPKWTGVL-KPKVFTED---YARYMRHLVDDHHEPTKGDLINQLQHFQL 276
            ||.                |..:| ||.:|.:.   |.:|.|.:.|...|.   :::.:.:..::
  Rat   221 FNA----------------WQALLIKPNIFFKISWLYRKYERSVKDLKDEI---EILVEKKRQKV 266

  Fly   277 SRSSNHYSQHPDFV-----ASQAGII------------LLAGFETSSALMGFTLYELAKAPDIQE 324
            | |:.......||.     |.:.|.:            |:|..:|.|..:...|..:|:.|:::.
  Rat   267 S-SAEKLEDCMDFATDLIFAERRGDLTKENVNQCILEMLIAAPDTMSVTLYVMLLLIAEYPEVET 330

  Fly   325 RLRSELREAFISTATLSYDTLMTLPYLKMVCLEALRLYPAAAFV-NRECTSSASEGFSLQPHVDF 388
            .:..|: ...:....:....:..|..::....|:||..|....| .|.......:|:.::...:.
  Rat   331 AILKEI-HTVVGDRDIRIGDVQNLKVVENFINESLRYQPVVDLVMRRALEDDVIDGYPVKKGTNI 394

  Fly   389 IVPPGMPAYISILGLHRDERFWPEPCVFDPERFGPERSRHIHPMTYIPFGAGPHGCIGSRLGVLQ 453
            |        ::|..:||.| ::|:|..|..|.|    .:::....:.|||.||..|.|..:.::.
  Rat   395 I--------LNIGRMHRLE-YFPKPNEFTLENF----EKNVPYRYFQPFGFGPRSCAGKYIAMVM 446

  Fly   454 LKLGIVHILKQYWVETCER--------------------TVSEIRFNPKSFMLESENEIYLR 495
            :|:.:|.:||::.|:|.::                    .:.||.|:|::      :|.||:
  Rat   447 MKVVLVTLLKRFHVKTLQKRCIENMPKNNDLSLHLDEDSPIVEIIFSPRN------SEKYLK 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 100/506 (20%)
Cyp19a1NP_058781.2 CYP19A1 72..485 CDD:410709 92/478 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.