DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t3 and Cyp4a2

DIOPT Version :9

Sequence 1:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster
Sequence 2:XP_038965182.1 Gene:Cyp4a2 / 24306 RGDID:2479 Length:517 Species:Rattus norvegicus


Alignment Length:577 Identity:132/577 - (22%)
Similarity:217/577 - (37%) Gaps:172/577 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LIWLLLLTIVTLNFWLRHKYDYFRSRGIPHLP--PSSWSPMGNLGQLLFLRI-----SF------ 54
            |:.|.|:....:.|:||.::   ..:.:...|  ||.|....||....|.::     .|      
  Rat    24 LLSLFLVLFKAVQFYLRRQW---LLKALEKFPSTPSHWLWGHNLKDREFQQVLTWVEKFPGACLQ 85

  Fly    55 ---GDLFRQLYAD--------------PRNGQAKIVGFFI--------FQ-----TPALMVRDPE 89
               |...|.|..|              |....|..:|:.:        ||     |||......:
  Rat    86 WLSGSTARVLLYDPDYVKVVLGRSDPKPYQSLAPWIGYGLLLLNGKKWFQHRRMLTPAFHYDILK 150

  Fly    90 LIRQVLIKNFNNFLNRFESADAGDPMGALTLPLAKYHHWKESRQCMSQLFTSGRMRDVMYSQ--- 151
            ...:::..:.:..|:::|..|..|.      ||..:|:        ..|.|...:....:|.   
  Rat   151 PYVKIMADSVSIMLDKWEKLDDQDH------PLEIFHY--------VSLMTLDTVMKCAFSHQGS 201

  Fly   152 -MLDVAS--------DLEQYL---------------NRKLGDRLERVLPLGRMCQLYTTDVTGNL 192
             .|||.|        ||...:               |.....||.|     |.||: ..:.||::
  Rat   202 VQLDVNSRSYTKAVEDLNNLIFFRVRSAFYGNSIIYNMSSDGRLSR-----RACQI-AHEHTGSV 260

  Fly   193 -----FYSLNVGGLRRGRSELITKTKELFNTNPRKVLDFMSVFFLPKWTGVLKPKVFTEDYARYM 252
                 |.||:.|.::..:::| ...:||.....::.|||:.:....|                  
  Rat   261 FLLPAFLSLSDGVIKTRKAQL-QNEEELQKARKKRHLDFLDILLFAK------------------ 306

  Fly   253 RHLVDDHHEPTKGDLINQLQHFQLSRSSNHYSQHPDFVASQAGIILLAGFETSSALMGFTLYELA 317
               ::|....:..||..::..|                       :..|.:|:::.:.:..|.||
  Rat   307 ---MEDGKSLSDEDLRAEVDTF-----------------------MFEGHDTTASGISWVFYALA 345

  Fly   318 KAPDIQERLRSELREAFISTATLSYDTLMTLPYLKMVCLEALRLYPAAAFVNRECTSSAS--EGF 380
            ..|:.|||.|.|::.......::::|.|..:||..|...||||||.....|:||.:|..:  :|.
  Rat   346 THPEHQERCREEVQSILGDGTSVTWDHLDQMPYTTMCIKEALRLYSPVPSVSRELSSPVTFPDGR 410

  Fly   381 SLQPHVDFIVPPGMPAYISILGLHRDERFWPEPCVFDPERFGPERSRHIHPMTYIPFGAGPHGCI 445
            |        :|.|:...|.|.|||.:..:||.|.||||.||.|:..||.|  .|:||..|...||
  Rat   411 S--------IPKGIRVTILIYGLHHNPSYWPNPKVFDPSRFSPDSPRHSH--AYLPFSGGARNCI 465

  Fly   446 GSRLGVLQLKLGIVHILKQYWVETCERTVSEIRFNP-------KSFMLESENEIYLR 495
            |.:..:.:||:.:...|.::          |:..:|       ...:|:|:|.|:||
  Rat   466 GKQFAMNELKVAVALTLLRF----------ELLPDPTRIPVPMPRLVLKSKNGIHLR 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 120/535 (22%)
Cyp4a2XP_038965182.1 CYP4B-like 69..512 CDD:410771 118/527 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.