DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t3 and cyp-34A1

DIOPT Version :9

Sequence 1:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_506787.1 Gene:cyp-34A1 / 188399 WormBaseID:WBGene00011698 Length:504 Species:Caenorhabditis elegans


Alignment Length:571 Identity:132/571 - (23%)
Similarity:211/571 - (36%) Gaps:148/571 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLIWLLLLTIVTLNFWLRHKYDYFRSRGIPHLP--PSSWSPMGNLGQLLFLRISFGDLFRQLYA 63
            |.|: ||..||::|.  |.|::     |....||  |.....:|||.|||:.....|.|. :.||
 Worm     1 MFLV-LLFFTIISLA--LAHQW-----RARKQLPRGPYPLPLIGNLHQLLYYCWKNGGLV-EGYA 56

  Fly    64 DPRNGQAKIVGFFIFQTPALMVRDPELIRQVLIKNFNNFLNRFESADAGDPMGALTLPLAKYHHW 128
            :.:....|:...:|...|.:.:.|.|:..:..:|..:.|..|:...            |..|:.:
 Worm    57 EIQKSFGKVYTLWIGPLPTVFIADFEVAHETHVKRAHEFGTRYAPG------------LMNYNRY 109

  Fly   129 -------------KESRQCMSQL--FTSGRMRDVMYSQMLDVASDLEQYLNRKLGDRLERVLPLG 178
                         :.||..:|..  |.||  |::|..:::|      :|..     |.|......
 Worm   110 ERGVVASNGEFFQEHSRFVLSTFRNFASG--RNIMEERIMD------EYRY-----RFEDFASSN 161

  Fly   179 RMC----QLYTTDVTGNLFYSLNVGG-----LRRGRSE--------LITKTKELF-NTNPRKVLD 225
            .:|    :::.|  ....|:.|..|.     |...|.|        |:::..:.| ||.      
 Worm   162 GICNKERKIFET--WARPFFDLLTGSVINKILINERFEQNDPEFEKLVSRLAKGFENTG------ 218

  Fly   226 FMSVF---------FLPKW--TGVLKP-----KVFTEDYARYMRHLVDDHH----EPTKGDLINQ 270
            |:.:|         || ||  ..:.:|     ::..:..||.:..|..|.|    :|  .|.::.
 Worm   219 FLDIFCPVRILESRFL-KWRQDTIFEPFNYILELNKKSIARRVAQLKADEHVLSDDP--DDFLDA 280

  Fly   271 LQHFQLSRSSNHYSQHPDFVASQAGI----ILLAGFETSSALMGFTLYELAKAPDIQERLRSELR 331
            .. .::.:..|. .....|......:    :.|.|.||:|..:.:....|...||:....|.||.
 Worm   281 YL-LKMQKDKNE-GLETTFTLENLAVDMYDLWLGGQETTSTTLNWACACLLNRPDVITTAREELI 343

  Fly   332 EAFISTATLSYDTLMTLPYLKMVCLEALRLYPAAAFVNRECTSSASEGFSLQPHVDFIVPPGMP- 395
            .......:||.......|||..|..|..|.   |:.:|........|        |.:| .|.| 
 Worm   344 RVTGGHRSLSLIDRRETPYLSAVISEVQRF---ASILNMNLFRIIKE--------DTVV-DGQPL 396

  Fly   396 -------AYISILGLHRDERFWPEPCVFDPERF--GPERSRHIHPMTYIPFGAGPHGCIGSRLGV 451
                   |:|::  :|.||..:.....|.||||  ..:..:.:     ||||.|...|:|..|..
 Worm   397 RAGTAVTAHIAM--IHVDEDLFKNHTEFRPERFLENDDLDKKL-----IPFGIGRRSCLGESLAK 454

  Fly   452 LQLKLGIVHILKQYWVETCERTVSEIRFNPK-----SF-MLESENEIYLRF 496
            .:|.|.:.::|..|.:|    .|.||   ||     .| :|:...|..:||
 Worm   455 AELYLVLGNLLLDYDLE----PVGEI---PKLKTLAPFGLLKQSPEFRIRF 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 117/526 (22%)
cyp-34A1NP_506787.1 p450 26..498 CDD:278495 119/536 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.