DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t3 and Cyp3a62

DIOPT Version :9

Sequence 1:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001019403.1 Gene:Cyp3a62 / 170509 RGDID:1595919 Length:497 Species:Rattus norvegicus


Alignment Length:511 Identity:151/511 - (29%)
Similarity:239/511 - (46%) Gaps:50/511 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WLLLLTI-VTLNFWLRHKYDYFRSRGIPHLPPSSWSPMGNLGQLLFLRISFGDLFR---QLYADP 65
            |:||.|| |.|..:....:..|:..||     |...|:..:|.:|..|..|.:..|   :.|.| 
  Rat    12 WMLLATILVLLYLYGTSTHGNFKKLGI-----SGPKPLPFVGNILAYRHGFWEFDRHCHKKYGD- 70

  Fly    66 RNGQAKIVGFFIFQTPALMVRDPELIRQVLIKN-FNNFLNRFESADAGDPMGALTLPLAKYHHWK 129
                  |.||:..:.|.|.:.||::|:.||:|. ::.|.||.....||....|:|  |::...||
  Rat    71 ------IWGFYEGRQPILAITDPDIIKTVLVKECYSTFTNRRSFGPAGILKKAIT--LSEDEEWK 127

  Fly   130 ESRQCMSQLFTSGRMRDVMYSQMLDVASDLEQYLNRKLGDRLERVLPLGR--MCQLYTTDVTGNL 192
            ..|..:|..||||:::     :|..:.:.....|.:.:....|:..|:..  :...|:.||....
  Rat   128 RLRTLLSPTFTSGKLK-----EMFPIINQYADLLVKNVKHEAEKGNPITMKDIFGAYSMDVITGT 187

  Fly   193 FYSLNVGGLRRGRSELITKTKELFNTNPRKVLD--FMSVFFLPKWTGVLKP---KVFTEDYARYM 252
            .:.:||..|...::..:.|.|:|...|   .||  |:||...|..|.|.:.   .||.:|..::.
  Rat   188 SFGVNVDSLNNPQNPFVQKVKKLLKFN---FLDPFFLSVILFPFLTPVFEAFDITVFPKDVMKFF 249

  Fly   253 RHLVDDHHEPTKGDLINQ-LQHFQL---SRSSNHYSQHPDF----VASQAGIILLAGFETSSALM 309
            |..|:...|....:.:.| |...||   |:||.....|...    :.:|:...:.||:||:|:.:
  Rat   250 RTSVERMKENRMQEKVKQRLDFLQLMINSQSSGDKESHQGLTDVEIVAQSIFFIFAGYETTSSAL 314

  Fly   310 GFTLYELAKAPDIQERLRSELREAFISTATLSYDTLMTLPYLKMVCLEALRLYPAAAFVNRECTS 374
            .|.||.||..||:|::|:.|:..|..:.|.::||.|:.:.||.||..|.|||:|....:.|.|..
  Rat   315 SFALYLLATHPDLQKKLQDEIDAALPNKAPVTYDVLVEMEYLDMVLNETLRLFPVGGRLERVCKK 379

  Fly   375 SASEGFSLQPHVDFIVPPGMPAYISILGLHRDERFWPEPCVFDPERFGPERSRHIHPMTYIPFGA 439
            .....       ...:|.|....:....||:|.:.||||..|.||||..:....|:|..|:|||.
  Rat   380 DVEIN-------GVFIPKGTVVMVPTFALHKDPKCWPEPEEFCPERFRKKNQDSINPYIYLPFGN 437

  Fly   440 GPHGCIGSRLGVLQLKLGIVHILKQYWVETCERTVSEIRFNPKSFMLESENEIYLR 495
            ||..|||.|..::.:|:.:|.:|:.:....|:.|...::...|.| .:.|..|.||
  Rat   438 GPRNCIGMRFALMNMKIALVRVLQNFSFGLCKETQIPLKLRKKGF-FQPEKPIILR 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 137/470 (29%)
Cyp3a62NP_001019403.1 p450 39..491 CDD:278495 139/476 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0158
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X40
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.