DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t3 and Cyp4a14

DIOPT Version :9

Sequence 1:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_031848.1 Gene:Cyp4a14 / 13119 MGIID:1096550 Length:507 Species:Mus musculus


Alignment Length:577 Identity:134/577 - (23%)
Similarity:217/577 - (37%) Gaps:172/577 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LIWLLLLTIVTLNFWLRHKYDYFRSRGIPHLP--PSSWSPMGN------LGQLLF---------L 50
            |:.|.|:....:.|:||.::   ..:.:.|.|  ||.|. .|:      |.|:|.         |
Mouse    24 LLSLFLVLFKAVQFYLRRQW---LLKTLQHFPCMPSHWL-WGHHLKDKELQQILIWVEKFPSACL 84

  Fly    51 RISFGDLFRQLYADP-------RNGQAKIVGFFIFQTP-----ALMVRDPELIR----------- 92
            :...|...|.|..||       .....|..|.:.|..|     .|::...:..:           
Mouse    85 QCLSGSNIRVLLYDPDYVKVVLGRSDPKASGIYQFFAPWIGYGLLLLNGKKWFQHRRMLTPAFHY 149

  Fly    93 -------QVLIKNFNNFLNRFESADAGDPMGALTLPLAKYHHWKESRQCMSQLFTSGRMRDVMYS 150
                   :::..:.|..|:::|..|..|.      ||..:|       |:| |.|...:....:|
Mouse   150 DILKPYVKIMADSVNIMLDKWEKLDGQDH------PLEIFH-------CVS-LMTLDTVMKCAFS 200

  Fly   151 QMLDVASDLEQYLNRKLGDRLERVLPLGRMCQLYTTDVTGNLFYSLNV----------------- 198
            ....|..|....|..|..:.|.. |...|:         .|.||..|:                 
Mouse   201 YQGSVQLDENSKLYTKAVEDLNN-LTFFRL---------RNAFYKYNIIYNMSSDGRLSHHACQI 255

  Fly   199 -----GGLRRGRSELITKTKELFNTNPRKVLDFMSVFFLPKWTGVLKPKVFTEDYARYMRHLVDD 258
                 .|:.:.|...:...:||.....::.|||:.:..                :||     ::|
Mouse   256 AHEHTDGVIKMRKSQLQNEEELQKARKKRHLDFLDILL----------------FAR-----MED 299

  Fly   259 HHEPTKGDLINQLQHFQLSRSSNHYSQHPDFVASQAGIILLAGFETSSALMGFTLYELAKAPDIQ 323
            .:..:..||..::..|                       :..|.:|:::.:.:..|.||..|:.|
Mouse   300 RNSLSDEDLRAEVDTF-----------------------MFEGHDTTASGISWIFYALATHPEHQ 341

  Fly   324 ERLRSELREAFISTATLSYDTLMTLPYLKMVCLEALRLYPAAAFVNRECTSSAS--EGFSLQPHV 386
            :|.|.|::.......::::|.|..:||..|...|||||||....|:||.:|..:  :|.|     
Mouse   342 QRCREEVQSILGDGTSVTWDHLGQMPYTTMCIKEALRLYPPVISVSRELSSPVTFPDGRS----- 401

  Fly   387 DFIVPPGMPAYISILGLHRDERFWPEPCVFDPERFGPERSRHIHPMTYIPFGAGPHGCIGSRLGV 451
               :|.|:.|.|||.|||.:.||||.|.||||.||.|:.|.|.|  .|:||..|...|||.:..:
Mouse   402 ---IPKGITATISIYGLHHNPRFWPNPKVFDPSRFAPDSSHHSH--AYLPFSGGSRNCIGKQFAM 461

  Fly   452 LQLKLGIVHILKQYWVETCERTVSEIRFNP-------KSFMLESENEIYLRFCRSSL 501
            .:||:.:...|.::          |:..:|       ...:|:|:|.|:|  |...|
Mouse   462 NELKVAVALTLLRF----------ELLPDPTRIPVPIARLVLKSKNGIHL--CLKKL 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 120/529 (23%)
Cyp4a14NP_031848.1 p450 52..501 CDD:278495 124/537 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.