DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t3 and Cyp4a12b

DIOPT Version :9

Sequence 1:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_758510.2 Gene:Cyp4a12b / 13118 MGIID:3611747 Length:508 Species:Mus musculus


Alignment Length:520 Identity:115/520 - (22%)
Similarity:206/520 - (39%) Gaps:75/520 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLLLTIVTLNFWLRHKYDYFRSRGIPHLPPSSWSPMGNLGQLLFLRISFGDLFRQLYADPRNGQA 70
            ||||...|...:|..::....::..|. |||.|.    .|..:.......|:..::...|.....
Mouse    27 LLLLLFKTAQLYLHRQWLLSSTQQFPS-PPSHWL----FGHKILKDQDLQDILTRIKNFPSACPQ 86

  Fly    71 KIVGFFIFQTPALMVRDPELIRQVLIKNFNNFLNRFESADAGD-----PMGALTLPLAKYHHWKE 130
            .:.|..:    .:.|.||:.::.:        |.|.:....|.     |.....|.|.....|.:
Mouse    87 WLWGSKV----RIQVYDPDYMKLI--------LGRSDPKAHGSYRFLAPWIGRGLLLLDGQTWFQ 139

  Fly   131 SRQCMSQLFTSGRMR---DVMYSQMLDVASDLEQYLNRKLGDRLERVLPLGRMCQLYTTDVTGNL 192
            .|:.::..|....::   ::|...:..:....||.:.:      :..|.:.:...|.|.|.....
Mouse   140 HRRMLTPAFHYDILKPYTEIMADSVHVMLDKWEQIVGQ------DSTLEIFQHITLMTLDTIMKC 198

  Fly   193 FYSLNVGGLRRGRS-----ELITKTKELFNTNPRKVLDFMSVFFLPKWTGVLKPKV------FTE 246
            .:| :.|.::..|.     :.:.....||....|.:.....:.:.....|.|....      .|:
Mouse   199 AFS-HEGSVQLDRKYKSYIQAVEDLNNLFFLRVRNIFHQNDIIYRVSSNGCLANSACQLAHDHTD 262

  Fly   247 DYARYMRHLVDDHHEPTKGDLINQLQHFQL---SRSSNHYSQHPDFVASQAGIILLAGFETSSAL 308
            ...:..|..:.|..|..|.....:|....:   :|..|..|.....:.::....:..|.:|:::.
Mouse   263 QVIKSRRSQLQDEEELEKLKKKRRLDFLDILLFARMENGKSLSDKDLRAEVDTFMFEGHDTTASG 327

  Fly   309 MGFTLYELAKAPDIQERLRSELREAFISTATLSYDTLMTLPYLKMVCLEALRLYPAAAFVNRECT 373
            :.:..|.||..|:.|:|.|.|::......|:::::.|..:||..|...||||:||....|:||.:
Mouse   328 ISWIFYALATNPEHQQRCRKEIQSLLGDGASITWNDLDKMPYTTMCIKEALRIYPPVPSVSRELS 392

  Fly   374 SSAS--EGFSLQPHVDFIVPPGMPAYISILGLHRDERFWPEPCVFDPERFGPERSRHIHPMTYIP 436
            |..:  :|.||        |.|:...:|..|||.:...||.|.||||.||.|..|||.|  :::|
Mouse   393 SPVTFPDGRSL--------PKGIHVMLSFYGLHHNPTVWPNPEVFDPSRFAPGSSRHSH--SFLP 447

  Fly   437 FGAGPHGCIGSRLGVLQLKLGIVHILKQYWVETCERTVSEIRFNP-------KSFMLESENEIYL 494
            |..|...|||.:..:.:||:.:...|.::          |:..:|       ...:|:|:|.|:|
Mouse   448 FSGGARNCIGKQFAMNELKVAVALTLLRF----------ELLPDPTRVPIPIPRIVLKSKNGIHL 502

  Fly   495  494
            Mouse   503  502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 103/482 (21%)
Cyp4a12bNP_758510.2 CYP4B-like 70..503 CDD:410771 103/472 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.