DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t3 and CYP4F22

DIOPT Version :9

Sequence 1:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_775754.2 Gene:CYP4F22 / 126410 HGNCID:26820 Length:531 Species:Homo sapiens


Alignment Length:539 Identity:128/539 - (23%)
Similarity:228/539 - (42%) Gaps:87/539 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LLIWLLLLTIVTLNFWLRHKYDYF----RSRGIPHLPPSSWSPMGNLGQLLFLRISFGDLFRQLY 62
            ||::||......|..:||....::    |.|..|..|..:|. :|:||..|.......|..:.| 
Human    27 LLLFLLFFLFRLLLRFLRLCRSFYITCRRLRCFPQPPRRNWL-LGHLGMYLPNEAGLQDEKKVL- 89

  Fly    63 ADPRNGQAKIVGFFIFQTPALMVRDPELIRQVLIKN---------FNNFLNRFESADAGDPMGAL 118
               .|....::.:.....|.|::..|:.|:.:|..:         |..||..:    .||  |.|
Human    90 ---DNMHHVLLVWMGPVLPLLVLVHPDYIKPLLGASAAIAPKDDLFYGFLKPW----LGD--GLL 145

  Fly   119 TLPLAKYHHWKESRQCMSQLFTSGRMRDVM--YSQMLDVASDLEQYLNRKLGDRLERVLPLGRMC 181
               |:|...|...|:.::..|..    |::  |.::.:.::|:.....|.|.:.....|.:....
Human   146 ---LSKGDKWSRHRRLLTPAFHF----DILKPYMKIFNQSADIMHAKWRHLAEGSAVSLDMFEHI 203

  Fly   182 QLYTTDVTGNLFYSLNVGGLRRGRSELITKTKELFNTNPRK------VLDFMSVFFLPKWTGVLK 240
            .|.|.|......:|.| ...:...|:.|:...||...:.|:      .|||  :::.        
Human   204 SLMTLDSLQKCVFSYN-SNCQEKMSDYISAIIELSALSVRRQYRLHHYLDF--IYYR-------- 257

  Fly   241 PKVFTEDYARYMRHLVDDHHEPT----------------------KGDLINQLQHFQLSRSSNHY 283
                :.|..|:.:.....||..|                      :|..::.:....|:|..:..
Human   258 ----SADGRRFRQACDMVHHFTTEVIQERRRALRQQGAEAWLKAKQGKTLDFIDVLLLARDEDGK 318

  Fly   284 SQHPDFVASQAGIILLAGFETSSALMGFTLYELAKAPDIQERLRSELREAF--ISTATLSYDTLM 346
            ....:.:.::|...:..|.:|:|:.:.:.|:.|||.|:.||:.|.|::|..  .....|.:|.|.
Human   319 ELSDEDIRAEADTFMFEGHDTTSSGISWMLFNLAKYPEYQEKCREEIQEVMKGRELEELEWDDLT 383

  Fly   347 TLPYLKMVCLEALRLYPAAAFVNRECTSSASEGFSLQPHVDFIVPPGMPAYISILGLHRDERFWP 411
            .||:..|...|:||.||....|:|:||    |...|..  ..|:|.|:...:||.|.|.:...||
Human   384 QLPFTTMCIKESLRQYPPVTLVSRQCT----EDIKLPD--GRIIPKGIICLVSIYGTHHNPTVWP 442

  Fly   412 EPCVFDPERFGPERSRHIHPMTYIPFGAGPHGCIGSRLGVLQLKLGIVHILKQYWVETCERTVSE 476
            :..|::|.||.|:..:...|:.|:||.|||..|||....:.:|::.:...|.::.: :.:|| .:
Human   443 DSKVYNPYRFDPDNPQQRSPLAYVPFSAGPRNCIGQSFAMAELRVVVALTLLRFRL-SVDRT-RK 505

  Fly   477 IRFNPKSFMLESENEIYLR 495
            :|..|: .:|.:||.::|:
Human   506 VRRKPE-LILRTENGLWLK 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 114/492 (23%)
CYP4F22NP_775754.2 p450 60..524 CDD:278495 119/506 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.