DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t3 and LOC103692784

DIOPT Version :9

Sequence 1:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster
Sequence 2:XP_038935978.1 Gene:LOC103692784 / 103692784 RGDID:9252969 Length:337 Species:Rattus norvegicus


Alignment Length:267 Identity:73/267 - (27%)
Similarity:114/267 - (42%) Gaps:69/267 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 LITKTKELFNTNPRKVLDFMSVFFLPKWTGVLKPKVFTEDYARYMRHLVDDH-HEPTKGDLINQL 271
            |.:|||     :..|.|||:.|..|.|                      |:| .|.:..|:..:.
  Rat    97 LESKTK-----SKSKTLDFIDVLLLAK----------------------DEHGKELSDEDIRAEA 134

  Fly   272 QHFQLSRSSNHYSQHPDFVASQAGIILLAGFETSSALMGFTLYELAKAPDIQERLRSELREAF-- 334
            ..|.....|:                     :|:::.:.:.||.||:.|:.||....|:.|..  
  Rat   135 DTFMFGDESH---------------------DTTASTLSWILYNLARHPEYQESCLQEVWELLRD 178

  Fly   335 ISTATLSYDTLMTLPYLKMVCLEALRLYPAAAFVNRECTSSASEGFSLQPHVDFIVPPG--MP-- 395
            .....:.:|.|..||:|.|...|:|||:|.|..:.|.||.            |.::|.|  :|  
  Rat   179 REPEEIEWDDLAQLPFLTMCIKESLRLHPPAVDLLRRCTQ------------DIVLPDGRVIPKG 231

  Fly   396 --AYISILGLHRDERFWPEPCVFDPERFGPERSRHIHPMTYIPFGAGPHGCIGSRLGVLQLKLGI 458
              ..|||.|:|.:...||:|.|:||.||.||..:...|:::|||.|||..|||....:.::|:.:
  Rat   232 NICVISIFGIHHNPSVWPDPEVYDPFRFDPESRQKRSPLSFIPFSAGPRNCIGQTFAMNEMKVAV 296

  Fly   459 VHILKQY 465
            ...|.::
  Rat   297 ALTLLRF 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 73/267 (27%)
LOC103692784XP_038935978.1 cytochrome_P450 <1..328 CDD:425388 73/267 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.