DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t3 and LOC100487846

DIOPT Version :9

Sequence 1:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster
Sequence 2:XP_017950484.2 Gene:LOC100487846 / 100487846 -ID:- Length:512 Species:Xenopus tropicalis


Alignment Length:489 Identity:127/489 - (25%)
Similarity:231/489 - (47%) Gaps:42/489 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WLLLLTIVT-LNFWLRHKYDYFRSRGIPHLPPSSWSPMGNLGQLLFLRISFGDLFRQLYADPRNG 68
            |.||:.::| |.::....|..|:..|||     ..:|:..:|..|..|....:...:.:....| 
 Frog    12 WTLLVLLLTLLAYYAIWPYRLFKRYGIP-----GPTPIPFIGTFLGNRHGLMEFDMKCFKKYGN- 70

  Fly    69 QAKIVGFFIFQTPALMVRDPELIRQVLIKN-FNNFLNRFESADAGDPMGALTLPLAKYHHWKESR 132
               :.||:....|.|.:.||.:|:.:::|. :.||.||.:...:| |:.:..| ::|...||..|
 Frog    71 ---VWGFYDGPQPVLAILDPVIIKSIMVKECYTNFTNRRDFGLSG-PLKSSVL-MSKDEQWKRIR 130

  Fly   133 QCMSQLFTSGRMRDVMYSQMLDVASDLEQYLNRKLGDRLERVLPLGRMCQLYTTDVTGNLFYSLN 197
            ..:|..||||:::. |:..|......|.:.:::|:.::  ..|.:..:...|:.|...:..:|:|
 Frog   131 TVLSPTFTSGKLKQ-MFPLMKHYGELLVKNIHKKIDNK--EPLDMKSIFGSYSMDTILSTSFSVN 192

  Fly   198 VGGLRRGRSELITKTKELFNTNPRKVLDFMSVF--FLPKWTGVLKPKVFTEDYARYMRHLVDD-H 259
            |..:.......:|..:.||..:..|.|..:::.  ||..:...:.....:..:.::.:..|.. .
 Frog   193 VDSMNNPNDPFVTNARNLFTFSFFKPLFLITILCPFLVPFLDKMNFCFLSSKFLKFFKDAVASIK 257

  Fly   260 HEPTKGDLINQLQHFQL--SRSSNHYSQHPD------------FVASQAGIILLAGFETSSALMG 310
            .:..||..::::...||  ...||.....|:            .:.:|:.|.::||:||:|..:.
 Frog   258 KKRQKGAHMDRVDFLQLMVDAQSNEGESVPEEEKHRHKELSDTEILAQSLIFIMAGYETTSTTLM 322

  Fly   311 FTLYELAKAPDIQERLRSELREAFISTATLSYDTLMTLPYLKMVCLEALRLYPAAAFVNRECTSS 375
            |..|.:|:.||:|.:|..|:.....:.|..:||.||.:.|:.||..|.|||.|.|..::|.|..:
 Frog   323 FLTYNIARYPDVQRKLEEEINTLLPNKAPPTYDALMKMEYMDMVINETLRLLPPAIRIDRVCKKT 387

  Fly   376 AS-EGFSLQPHVDFIVPPGMPAYISILGLHRDERFWPEPCVFDPERFGPERSRHIHPMTYIPFGA 439
            .. .|.:        :|.|:...:.:..||.:...||||..|.||||..|..::..|..::|||.
 Frog   388 MEINGVT--------IPAGVVIVVPLFALHLNPEIWPEPEEFQPERFSKENQKNQDPYNFLPFGV 444

  Fly   440 GPHGCIGSRLGVLQLKLGIVHILKQYWVETCERT 473
            ||..|||.|..::.:||.:..:|:.:.:|||:.|
 Frog   445 GPRNCIGMRFALVNIKLALTILLQNFKLETCKDT 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 117/459 (25%)
LOC100487846XP_017950484.2 cytochrome_P450 67..498 CDD:425388 113/429 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.