DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t3 and cyp4f3

DIOPT Version :9

Sequence 1:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001083010.1 Gene:cyp4f3 / 100037390 ZFINID:ZDB-GENE-070410-108 Length:511 Species:Danio rerio


Alignment Length:466 Identity:109/466 - (23%)
Similarity:187/466 - (40%) Gaps:96/466 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 MVR--DPELIRQVLIKN---------FNNFLNRFESADAGDPMGALTLPLAKYHHWKESRQCMSQ 137
            |||  .|:.||.:|..:         |..|:.         |.....|.|.....|...|:.::.
Zfish    83 MVRLFHPDYIRSLLTASASITLKDRIFYGFMK---------PWLGNCLLLQSGQEWSRHRRLLTP 138

  Fly   138 LFTSGRMRDVM--YSQMLDVASDLEQYLNRKLGDRLERVLPLGRMCQLYTTDVTGNLFYSLNVGG 200
            .|..    |::  |..:.:.::::       :.|...|:|..|.    ::.|:...: .||.:..
Zfish   139 AFHF----DILKKYVHIFNQSTNI-------MHDEWRRLLAKGE----HSVDMFEQI-SSLTLDS 187

  Fly   201 LRRGRSELITKTKELFNTNPRK----VLDFMSVF-----FLP------KWTGVLKPKV------- 243
            |.:......|.::|    .||:    :||...:.     :||      .|......:.       
Zfish   188 LLKCTFSCDTHSQE----KPRQYISAILDLSRLLVQRQHYLPYHWDWLYWRSAQGRRFQQACAVV 248

  Fly   244 --FTEDYARYMRHLVDDHHEP-------------TKGDLINQLQHFQLSRSSNHYSQHPDFVASQ 293
              ||.|..:..|..:|...:|             ...|||:.|   .|::.........:.:.:.
Zfish   249 HQFTADIVQERRTQLDQQSDPESHPENTGRYRKRKNTDLIDLL---LLAKDDKGEGLTNEEIKAH 310

  Fly   294 AGIILLAGFETSSALMGFTLYELAKAPDIQERLRSELRE--AFISTATLSYDTLMTLPYLKMVCL 356
            |.:.:.||.:|:::.:.:..|.||...|.|||.|:|:|:  |...|.|:.::.|..|.:..|...
Zfish   311 ADMFMFAGHDTTASALSWIFYNLAMNQDYQERCRAEVRDLLADRDTHTIGWEDLSQLTFTTMCIK 375

  Fly   357 EALRLY-PAAAFVNRECTSSASEGFSLQPHVDFIVPPGMPAYISILGLHRDERFWPEPCVFDPER 420
            |:|||: |..|.......:..:.|       |.::|.|....|||.|:||:.:.||:|.||||.|
Zfish   376 ESLRLHSPVLALTRYYSQNMKTPG-------DCVIPHGCLCLISIYGVHRNPQVWPDPLVFDPTR 433

  Fly   421 FGPERSRHIHPMTYIPFGAGPHGCIGSRLGVLQLKLGIVHILKQYWVETCERTVSEIRFNPKSFM 485
            |.|..|....|..:|||.|||..|||....:.::|:.:...|.::.:....:.|..:    ...:
Zfish   434 FDPHNSDSRSPHAFIPFSAGPRNCIGQNFAMAEMKVVVALTLARFKILPGPKPVRRL----YQLV 494

  Fly   486 LESENEIYLRF 496
            |.:|..:.|.|
Zfish   495 LRAEGGMILHF 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 105/454 (23%)
cyp4f3NP_001083010.1 p450 38..503 CDD:278495 107/462 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.