DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t3 and cyp19a1

DIOPT Version :9

Sequence 1:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001090630.1 Gene:cyp19a1 / 100036594 XenbaseID:XB-GENE-953895 Length:500 Species:Xenopus tropicalis


Alignment Length:344 Identity:80/344 - (23%)
Similarity:143/344 - (41%) Gaps:71/344 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 VLPLGRMCQLYTTDVTGNLFYSLNVGGLRRGRSELITKTKELFNTNPRKVLDFMSVFFLPKWTG- 237
            ||.|.|:..|   |.:.|||..:.:     ..:|::.|.::.|:.                |.. 
 Frog   185 VLKLMRLIML---DTSNNLFLRIPL-----DENEIVLKIQKYFDA----------------WQAL 225

  Fly   238 VLKPKVFTEDYARYMRHLVDDHHEPTKGDLINQL-----QHFQLSRSSNHYSQHPDFV-----AS 292
            :|||.:|.:....|.:      :|.:..||...:     |..|...||....::.||.     |.
 Frog   226 LLKPDIFFKISWLYKK------YEKSANDLKEAIEILIEQKRQKLSSSEKLDENMDFASELIFAQ 284

  Fly   293 QAGII------------LLAGFETSSALMGFTLYELAKAPDIQERLRSELREAFISTATLSYDTL 345
            ..|.:            |:|..:|.|..:.|.|..:|:.|.|:|.:.:|: :..|....:..:.:
 Frog   285 NHGDLTAENVNQCILEMLIAAPDTMSVSLFFMLVLVAQHPKIEEGIMNEI-DNVIGDRDVESNDI 348

  Fly   346 MTLPYLKMVCLEALRLYPAAAFVNREC-TSSASEGFSLQPHVDFIVPPGMPAYISILGLHRDERF 409
            ..|..|:....|::|..|....|.|:. .....:|:.::...:.|:..|.        :||.| :
 Frog   349 PNLKVLENFIYESMRYQPVVDLVMRKALEDDMIDGYYVKKGTNIILNLGR--------MHRIE-Y 404

  Fly   410 WPEPCVFDPERFGPERSRHIHPMTYI-PFGAGPHGCIGSRLGVLQLKLGIVHILKQYWVETC-ER 472
            :|:|..|..|.|  |::   .|..|. |||:||..|.|..:.::.:|:.:|.:.|:|.|:|. .|
 Frog   405 FPKPNEFTLENF--EKT---VPYRYFQPFGSGPRACAGKYIAMVMMKVILVTLFKRYKVQTLGGR 464

  Fly   473 TVSEIRFNPKSFMLESENE 491
            .:..|:.|....|...|::
 Frog   465 CLENIQNNNDLSMHPDESQ 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 78/337 (23%)
cyp19a1NP_001090630.1 p450 46..486 CDD:365848 80/344 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.